BLASTX nr result
ID: Phellodendron21_contig00035747
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00035747 (384 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO74435.1 hypothetical protein CISIN_1g001142mg [Citrus sinensis] 84 2e-16 XP_006489471.1 PREDICTED: uncharacterized protein LOC102627898 i... 84 2e-16 XP_006420046.1 hypothetical protein CICLE_v10004189mg [Citrus cl... 84 2e-16 XP_006489470.1 PREDICTED: uncharacterized protein LOC102627898 i... 84 2e-16 KDO74431.1 hypothetical protein CISIN_1g001142mg [Citrus sinensis] 84 2e-16 >KDO74435.1 hypothetical protein CISIN_1g001142mg [Citrus sinensis] Length = 1074 Score = 84.3 bits (207), Expect = 2e-16 Identities = 45/60 (75%), Positives = 49/60 (81%), Gaps = 1/60 (1%) Frame = -3 Query: 178 MQLTNSVETPQKSYESPSKQKLPLEASNTDNEDNGSVN-DDGDSVIDVSGKSVDFPLIES 2 MQLTNSVE QKS E P K+KLP EA+ +NE NGSVN DD DSVIDVSGK+VDFPLIES Sbjct: 1 MQLTNSVEITQKSPEGPIKEKLPSEANKINNEKNGSVNDDDDDSVIDVSGKTVDFPLIES 60 >XP_006489471.1 PREDICTED: uncharacterized protein LOC102627898 isoform X2 [Citrus sinensis] KDO74429.1 hypothetical protein CISIN_1g001142mg [Citrus sinensis] Length = 1137 Score = 84.3 bits (207), Expect = 2e-16 Identities = 45/60 (75%), Positives = 49/60 (81%), Gaps = 1/60 (1%) Frame = -3 Query: 178 MQLTNSVETPQKSYESPSKQKLPLEASNTDNEDNGSVN-DDGDSVIDVSGKSVDFPLIES 2 MQLTNSVE QKS E P K+KLP EA+ +NE NGSVN DD DSVIDVSGK+VDFPLIES Sbjct: 1 MQLTNSVEITQKSPEGPIKEKLPSEANKINNEKNGSVNDDDDDSVIDVSGKTVDFPLIES 60 >XP_006420046.1 hypothetical protein CICLE_v10004189mg [Citrus clementina] ESR33286.1 hypothetical protein CICLE_v10004189mg [Citrus clementina] Length = 1137 Score = 84.3 bits (207), Expect = 2e-16 Identities = 45/60 (75%), Positives = 49/60 (81%), Gaps = 1/60 (1%) Frame = -3 Query: 178 MQLTNSVETPQKSYESPSKQKLPLEASNTDNEDNGSVN-DDGDSVIDVSGKSVDFPLIES 2 MQLTNSVE QKS E P K+KLP EA+ T+NE N SVN DD DSVIDVSGK+VDFPLIES Sbjct: 1 MQLTNSVEIAQKSPEGPIKEKLPSEANKTNNEKNSSVNDDDDDSVIDVSGKTVDFPLIES 60 >XP_006489470.1 PREDICTED: uncharacterized protein LOC102627898 isoform X1 [Citrus sinensis] KDO74430.1 hypothetical protein CISIN_1g001142mg [Citrus sinensis] Length = 1141 Score = 84.3 bits (207), Expect = 2e-16 Identities = 45/60 (75%), Positives = 49/60 (81%), Gaps = 1/60 (1%) Frame = -3 Query: 178 MQLTNSVETPQKSYESPSKQKLPLEASNTDNEDNGSVN-DDGDSVIDVSGKSVDFPLIES 2 MQLTNSVE QKS E P K+KLP EA+ +NE NGSVN DD DSVIDVSGK+VDFPLIES Sbjct: 1 MQLTNSVEITQKSPEGPIKEKLPSEANKINNEKNGSVNDDDDDSVIDVSGKTVDFPLIES 60 >KDO74431.1 hypothetical protein CISIN_1g001142mg [Citrus sinensis] Length = 1142 Score = 84.3 bits (207), Expect = 2e-16 Identities = 45/60 (75%), Positives = 49/60 (81%), Gaps = 1/60 (1%) Frame = -3 Query: 178 MQLTNSVETPQKSYESPSKQKLPLEASNTDNEDNGSVN-DDGDSVIDVSGKSVDFPLIES 2 MQLTNSVE QKS E P K+KLP EA+ +NE NGSVN DD DSVIDVSGK+VDFPLIES Sbjct: 1 MQLTNSVEITQKSPEGPIKEKLPSEANKINNEKNGSVNDDDDDSVIDVSGKTVDFPLIES 60