BLASTX nr result
ID: Phellodendron21_contig00035736
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00035736 (411 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006472617.1 PREDICTED: putative pumilio homolog 7, chloroplas... 55 2e-09 KDO80944.1 hypothetical protein CISIN_1g038006mg [Citrus sinensis] 55 3e-09 XP_006434001.1 hypothetical protein CICLE_v10000337mg [Citrus cl... 55 3e-09 EEF48492.1 conserved hypothetical protein [Ricinus communis] 52 4e-06 XP_015571609.1 PREDICTED: putative pumilio homolog 7, chloroplas... 52 4e-06 >XP_006472617.1 PREDICTED: putative pumilio homolog 7, chloroplastic [Citrus sinensis] XP_006472618.1 PREDICTED: putative pumilio homolog 7, chloroplastic [Citrus sinensis] XP_015384156.1 PREDICTED: putative pumilio homolog 7, chloroplastic [Citrus sinensis] Length = 785 Score = 55.1 bits (131), Expect(2) = 2e-09 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 411 ILLMVTEEPG*LLRVCLNTYGTRVVQKFIGT 319 ILLMVTEEPG L+RVCLNTYGTRVVQK I T Sbjct: 537 ILLMVTEEPGQLVRVCLNTYGTRVVQKLIET 567 Score = 33.9 bits (76), Expect(2) = 2e-09 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 316 QISLVKAALKFGFLDLIKE 260 QISLVKAALK GFLDLIK+ Sbjct: 573 QISLVKAALKPGFLDLIKD 591 >KDO80944.1 hypothetical protein CISIN_1g038006mg [Citrus sinensis] Length = 808 Score = 55.1 bits (131), Expect(2) = 3e-09 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 411 ILLMVTEEPG*LLRVCLNTYGTRVVQKFIGT 319 ILLMVTEEPG L+RVCLNTYGTRVVQK I T Sbjct: 558 ILLMVTEEPGQLVRVCLNTYGTRVVQKLIET 588 Score = 33.5 bits (75), Expect(2) = 3e-09 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -3 Query: 316 QISLVKAALKFGFLDLIKE 260 Q+SLVKAALK GFLDLIK+ Sbjct: 594 QVSLVKAALKPGFLDLIKD 612 >XP_006434001.1 hypothetical protein CICLE_v10000337mg [Citrus clementina] ESR47241.1 hypothetical protein CICLE_v10000337mg [Citrus clementina] Length = 789 Score = 55.1 bits (131), Expect(2) = 3e-09 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 411 ILLMVTEEPG*LLRVCLNTYGTRVVQKFIGT 319 ILLMVTEEPG L+RVCLNTYGTRVVQK I T Sbjct: 541 ILLMVTEEPGQLVRVCLNTYGTRVVQKLIET 571 Score = 33.5 bits (75), Expect(2) = 3e-09 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -3 Query: 316 QISLVKAALKFGFLDLIKE 260 Q+SLVKAALK GFLDLIK+ Sbjct: 577 QVSLVKAALKPGFLDLIKD 595 >EEF48492.1 conserved hypothetical protein [Ricinus communis] Length = 1204 Score = 51.6 bits (122), Expect(2) = 4e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 411 ILLMVTEEPG*LLRVCLNTYGTRVVQKFIGT 319 I+ MVTEEPG LLR+CLNTYGTR VQK I T Sbjct: 956 IVFMVTEEPGQLLRICLNTYGTRAVQKLIET 986 Score = 26.2 bits (56), Expect(2) = 4e-06 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -3 Query: 316 QISLVKAALKFGFLDLIKE 260 QIS V AL+ GFLDL+K+ Sbjct: 992 QISFVVMALRPGFLDLVKD 1010 >XP_015571609.1 PREDICTED: putative pumilio homolog 7, chloroplastic [Ricinus communis] XP_015571610.1 PREDICTED: putative pumilio homolog 7, chloroplastic [Ricinus communis] Length = 793 Score = 51.6 bits (122), Expect(2) = 4e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 411 ILLMVTEEPG*LLRVCLNTYGTRVVQKFIGT 319 I+ MVTEEPG LLR+CLNTYGTR VQK I T Sbjct: 545 IVFMVTEEPGQLLRICLNTYGTRAVQKLIET 575 Score = 26.2 bits (56), Expect(2) = 4e-06 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -3 Query: 316 QISLVKAALKFGFLDLIKE 260 QIS V AL+ GFLDL+K+ Sbjct: 581 QISFVVMALRPGFLDLVKD 599