BLASTX nr result
ID: Phellodendron21_contig00035718
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00035718 (365 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO59446.1 hypothetical protein CISIN_1g003504mg [Citrus sinensis] 131 5e-33 XP_006473994.1 PREDICTED: probable LRR receptor-like serine/thre... 131 5e-33 CAN70754.1 hypothetical protein VITISV_014698 [Vitis vinifera] 118 3e-32 KHN42819.1 Putative LRR receptor-like serine/threonine-protein k... 127 1e-31 XP_003518219.1 PREDICTED: probable LRR receptor-like serine/thre... 127 1e-31 XP_006453627.1 hypothetical protein CICLE_v10007429mg [Citrus cl... 125 4e-31 EEF29422.1 ATP binding protein, putative [Ricinus communis] 123 3e-30 XP_002532956.2 PREDICTED: probable LRR receptor-like serine/thre... 123 3e-30 OIV99848.1 hypothetical protein TanjilG_26186 [Lupinus angustifo... 120 8e-30 XP_003549546.1 PREDICTED: probable LRR receptor-like serine/thre... 121 1e-29 AMM42927.1 LRR-RLK, partial [Vernicia montana] 115 3e-29 XP_019463216.1 PREDICTED: probable LRR receptor-like serine/thre... 120 4e-29 KYP53605.1 putative LRR receptor-like serine/threonine-protein k... 119 7e-29 XP_017983868.1 PREDICTED: probable LRR receptor-like serine/thre... 119 7e-29 EOY29563.1 Leucine-rich repeat protein kinase family protein [Th... 119 7e-29 XP_018850300.1 PREDICTED: probable LRR receptor-like serine/thre... 119 7e-29 AAF73754.1 receptor-like protein kinase, partial [Prunus dulcis] 113 8e-29 XP_017643001.1 PREDICTED: probable LRR receptor-like serine/thre... 118 1e-28 XP_016683142.1 PREDICTED: probable LRR receptor-like serine/thre... 118 1e-28 XP_016754932.1 PREDICTED: probable LRR receptor-like serine/thre... 118 1e-28 >KDO59446.1 hypothetical protein CISIN_1g003504mg [Citrus sinensis] Length = 815 Score = 131 bits (329), Expect = 5e-33 Identities = 63/70 (90%), Positives = 66/70 (94%) Frame = +2 Query: 2 EKEGNLVGWIRGLVRKNQVSRAIDPKIHDTGPEKQMEEALKIGYLCTADLPLKRPSMQQI 181 EKEGNLV W+RGLVR N+ SRAIDPKI DTGPEKQMEEALKIGYLCTADLPLKRPSMQQI Sbjct: 745 EKEGNLVSWVRGLVRNNKGSRAIDPKIRDTGPEKQMEEALKIGYLCTADLPLKRPSMQQI 804 Query: 182 VGLLKDVEST 211 VGLLKD+EST Sbjct: 805 VGLLKDIEST 814 >XP_006473994.1 PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g24230 [Citrus sinensis] Length = 852 Score = 131 bits (329), Expect = 5e-33 Identities = 63/70 (90%), Positives = 66/70 (94%) Frame = +2 Query: 2 EKEGNLVGWIRGLVRKNQVSRAIDPKIHDTGPEKQMEEALKIGYLCTADLPLKRPSMQQI 181 EKEGNLV W+RGLVR N+ SRAIDPKI DTGPEKQMEEALKIGYLCTADLPLKRPSMQQI Sbjct: 782 EKEGNLVSWVRGLVRNNKGSRAIDPKIRDTGPEKQMEEALKIGYLCTADLPLKRPSMQQI 841 Query: 182 VGLLKDVEST 211 VGLLKD+EST Sbjct: 842 VGLLKDIEST 851 >CAN70754.1 hypothetical protein VITISV_014698 [Vitis vinifera] Length = 114 Score = 118 bits (296), Expect = 3e-32 Identities = 57/68 (83%), Positives = 61/68 (89%) Frame = +2 Query: 2 EKEGNLVGWIRGLVRKNQVSRAIDPKIHDTGPEKQMEEALKIGYLCTADLPLKRPSMQQI 181 EKE +LV W+RGLVRKNQ SRAIDPKI TGP+ QMEEALKIGYLCTADLP KRPSMQQI Sbjct: 42 EKESSLVNWVRGLVRKNQGSRAIDPKIRGTGPDAQMEEALKIGYLCTADLPSKRPSMQQI 101 Query: 182 VGLLKDVE 205 VGLLKD+E Sbjct: 102 VGLLKDIE 109 >KHN42819.1 Putative LRR receptor-like serine/threonine-protein kinase [Glycine soja] Length = 633 Score = 127 bits (318), Expect = 1e-31 Identities = 59/70 (84%), Positives = 64/70 (91%) Frame = +2 Query: 2 EKEGNLVGWIRGLVRKNQVSRAIDPKIHDTGPEKQMEEALKIGYLCTADLPLKRPSMQQI 181 +KE LV W+RGLVRKNQ SRAIDPKIHDTGP++QMEEALKIGYLCTADLP KRPSMQQI Sbjct: 562 DKEATLVSWVRGLVRKNQASRAIDPKIHDTGPDEQMEEALKIGYLCTADLPFKRPSMQQI 621 Query: 182 VGLLKDVEST 211 VGLLKD+E T Sbjct: 622 VGLLKDIEPT 631 >XP_003518219.1 PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g24230 [Glycine max] KRH72299.1 hypothetical protein GLYMA_02G203600 [Glycine max] Length = 854 Score = 127 bits (318), Expect = 1e-31 Identities = 59/70 (84%), Positives = 64/70 (91%) Frame = +2 Query: 2 EKEGNLVGWIRGLVRKNQVSRAIDPKIHDTGPEKQMEEALKIGYLCTADLPLKRPSMQQI 181 +KE LV W+RGLVRKNQ SRAIDPKIHDTGP++QMEEALKIGYLCTADLP KRPSMQQI Sbjct: 783 DKEATLVSWVRGLVRKNQASRAIDPKIHDTGPDEQMEEALKIGYLCTADLPFKRPSMQQI 842 Query: 182 VGLLKDVEST 211 VGLLKD+E T Sbjct: 843 VGLLKDIEPT 852 >XP_006453627.1 hypothetical protein CICLE_v10007429mg [Citrus clementina] ESR66867.1 hypothetical protein CICLE_v10007429mg [Citrus clementina] Length = 853 Score = 125 bits (315), Expect = 4e-31 Identities = 60/67 (89%), Positives = 63/67 (94%) Frame = +2 Query: 2 EKEGNLVGWIRGLVRKNQVSRAIDPKIHDTGPEKQMEEALKIGYLCTADLPLKRPSMQQI 181 EKEGNLV W+RGLVR N+ SRAIDPKI DTGPEKQMEEALKIGYLCTADLPLKRPSMQQI Sbjct: 787 EKEGNLVSWVRGLVRNNKGSRAIDPKIRDTGPEKQMEEALKIGYLCTADLPLKRPSMQQI 846 Query: 182 VGLLKDV 202 VGLLKD+ Sbjct: 847 VGLLKDI 853 >EEF29422.1 ATP binding protein, putative [Ricinus communis] Length = 839 Score = 123 bits (308), Expect = 3e-30 Identities = 57/70 (81%), Positives = 65/70 (92%) Frame = +2 Query: 2 EKEGNLVGWIRGLVRKNQVSRAIDPKIHDTGPEKQMEEALKIGYLCTADLPLKRPSMQQI 181 EK+ LV W+RGLVRKNQ+SRAIDPKI +TGPE++MEEALKIGYLCTAD+PLKRPSMQQI Sbjct: 767 EKDATLVSWVRGLVRKNQMSRAIDPKIRNTGPEQEMEEALKIGYLCTADIPLKRPSMQQI 826 Query: 182 VGLLKDVEST 211 VGLLKD+E T Sbjct: 827 VGLLKDIEPT 836 >XP_002532956.2 PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g24230 [Ricinus communis] Length = 852 Score = 123 bits (308), Expect = 3e-30 Identities = 57/70 (81%), Positives = 65/70 (92%) Frame = +2 Query: 2 EKEGNLVGWIRGLVRKNQVSRAIDPKIHDTGPEKQMEEALKIGYLCTADLPLKRPSMQQI 181 EK+ LV W+RGLVRKNQ+SRAIDPKI +TGPE++MEEALKIGYLCTAD+PLKRPSMQQI Sbjct: 780 EKDATLVSWVRGLVRKNQMSRAIDPKIRNTGPEQEMEEALKIGYLCTADIPLKRPSMQQI 839 Query: 182 VGLLKDVEST 211 VGLLKD+E T Sbjct: 840 VGLLKDIEPT 849 >OIV99848.1 hypothetical protein TanjilG_26186 [Lupinus angustifolius] Length = 428 Score = 120 bits (300), Expect = 8e-30 Identities = 56/68 (82%), Positives = 61/68 (89%) Frame = +2 Query: 2 EKEGNLVGWIRGLVRKNQVSRAIDPKIHDTGPEKQMEEALKIGYLCTADLPLKRPSMQQI 181 +KE LV W+RGLVRKNQ SR IDPKI DTGP++QMEEALKIGYLCTADLP KRPSMQQI Sbjct: 357 DKEATLVSWVRGLVRKNQASRVIDPKIRDTGPDEQMEEALKIGYLCTADLPSKRPSMQQI 416 Query: 182 VGLLKDVE 205 VGLLKD+E Sbjct: 417 VGLLKDIE 424 >XP_003549546.1 PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g24230 isoform X1 [Glycine max] Length = 853 Score = 121 bits (304), Expect = 1e-29 Identities = 57/70 (81%), Positives = 63/70 (90%) Frame = +2 Query: 2 EKEGNLVGWIRGLVRKNQVSRAIDPKIHDTGPEKQMEEALKIGYLCTADLPLKRPSMQQI 181 +KE LV W+RGLVRKNQ SRAIDPKI DTGP++Q+EEALKIGYLCTADLP KRPSMQQI Sbjct: 783 DKEETLVSWVRGLVRKNQASRAIDPKIRDTGPDEQIEEALKIGYLCTADLPFKRPSMQQI 842 Query: 182 VGLLKDVEST 211 VGLLKD+E T Sbjct: 843 VGLLKDIEPT 852 >AMM42927.1 LRR-RLK, partial [Vernicia montana] Length = 290 Score = 115 bits (289), Expect = 3e-29 Identities = 54/68 (79%), Positives = 59/68 (86%) Frame = +2 Query: 2 EKEGNLVGWIRGLVRKNQVSRAIDPKIHDTGPEKQMEEALKIGYLCTADLPLKRPSMQQI 181 EKE LV W+RG+VRKNQ SR IDPKI DTGPE +MEE LKIGYLCTAD+P KRPSMQQI Sbjct: 219 EKEATLVSWVRGMVRKNQGSRTIDPKIRDTGPEYEMEETLKIGYLCTADIPSKRPSMQQI 278 Query: 182 VGLLKDVE 205 VGLLKD+E Sbjct: 279 VGLLKDIE 286 >XP_019463216.1 PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g24230 isoform X2 [Lupinus angustifolius] XP_019463217.1 PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g24230 isoform X3 [Lupinus angustifolius] XP_019463218.1 PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g24230 isoform X4 [Lupinus angustifolius] Length = 847 Score = 120 bits (300), Expect = 4e-29 Identities = 56/68 (82%), Positives = 61/68 (89%) Frame = +2 Query: 2 EKEGNLVGWIRGLVRKNQVSRAIDPKIHDTGPEKQMEEALKIGYLCTADLPLKRPSMQQI 181 +KE LV W+RGLVRKNQ SR IDPKI DTGP++QMEEALKIGYLCTADLP KRPSMQQI Sbjct: 776 DKEATLVSWVRGLVRKNQASRVIDPKIRDTGPDEQMEEALKIGYLCTADLPSKRPSMQQI 835 Query: 182 VGLLKDVE 205 VGLLKD+E Sbjct: 836 VGLLKDIE 843 >KYP53605.1 putative LRR receptor-like serine/threonine-protein kinase At2g24230 family [Cajanus cajan] Length = 748 Score = 119 bits (298), Expect = 7e-29 Identities = 56/70 (80%), Positives = 62/70 (88%) Frame = +2 Query: 2 EKEGNLVGWIRGLVRKNQVSRAIDPKIHDTGPEKQMEEALKIGYLCTADLPLKRPSMQQI 181 +KE LV W+RGLVRKNQ SRAIDPKI DTGP+++MEEALKI YLCTADLP KRPSMQQI Sbjct: 678 DKEATLVSWVRGLVRKNQGSRAIDPKIRDTGPDEEMEEALKIAYLCTADLPFKRPSMQQI 737 Query: 182 VGLLKDVEST 211 VGLLKD+E T Sbjct: 738 VGLLKDIEPT 747 >XP_017983868.1 PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g24230 [Theobroma cacao] Length = 853 Score = 119 bits (298), Expect = 7e-29 Identities = 57/68 (83%), Positives = 61/68 (89%) Frame = +2 Query: 2 EKEGNLVGWIRGLVRKNQVSRAIDPKIHDTGPEKQMEEALKIGYLCTADLPLKRPSMQQI 181 E+E LV W+RGLVRKNQ SRAIDPKI DTGP+ QMEEALKIGYLCTADLP KRPSMQQI Sbjct: 781 EQEATLVSWVRGLVRKNQGSRAIDPKIRDTGPDYQMEEALKIGYLCTADLPTKRPSMQQI 840 Query: 182 VGLLKDVE 205 VGLLKD+E Sbjct: 841 VGLLKDIE 848 >EOY29563.1 Leucine-rich repeat protein kinase family protein [Theobroma cacao] Length = 853 Score = 119 bits (298), Expect = 7e-29 Identities = 57/68 (83%), Positives = 61/68 (89%) Frame = +2 Query: 2 EKEGNLVGWIRGLVRKNQVSRAIDPKIHDTGPEKQMEEALKIGYLCTADLPLKRPSMQQI 181 E+E LV W+RGLVRKNQ SRAIDPKI DTGP+ QMEEALKIGYLCTADLP KRPSMQQI Sbjct: 781 EQEATLVSWVRGLVRKNQGSRAIDPKIRDTGPDYQMEEALKIGYLCTADLPTKRPSMQQI 840 Query: 182 VGLLKDVE 205 VGLLKD+E Sbjct: 841 VGLLKDIE 848 >XP_018850300.1 PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g24230 [Juglans regia] Length = 855 Score = 119 bits (298), Expect = 7e-29 Identities = 57/68 (83%), Positives = 60/68 (88%) Frame = +2 Query: 2 EKEGNLVGWIRGLVRKNQVSRAIDPKIHDTGPEKQMEEALKIGYLCTADLPLKRPSMQQI 181 E E NLV W+RGLVRKNQ SRAIDPKI DTGP+ QMEEALKIGYLCTADLP KRP MQQI Sbjct: 783 ENEANLVSWVRGLVRKNQGSRAIDPKIRDTGPDDQMEEALKIGYLCTADLPSKRPRMQQI 842 Query: 182 VGLLKDVE 205 VGLLKD+E Sbjct: 843 VGLLKDIE 850 >AAF73754.1 receptor-like protein kinase, partial [Prunus dulcis] Length = 221 Score = 113 bits (282), Expect = 8e-29 Identities = 53/68 (77%), Positives = 60/68 (88%) Frame = +2 Query: 2 EKEGNLVGWIRGLVRKNQVSRAIDPKIHDTGPEKQMEEALKIGYLCTADLPLKRPSMQQI 181 EK+ LV W+RGLV+KN+ + AIDPKI DTGP+ QMEEALKIGYLCTADLPLKRPSM QI Sbjct: 154 EKDATLVSWVRGLVKKNRGASAIDPKIRDTGPDDQMEEALKIGYLCTADLPLKRPSMHQI 213 Query: 182 VGLLKDVE 205 VGLLKD+E Sbjct: 214 VGLLKDME 221 >XP_017643001.1 PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g24230 [Gossypium arboreum] Length = 853 Score = 118 bits (296), Expect = 1e-28 Identities = 56/68 (82%), Positives = 62/68 (91%) Frame = +2 Query: 2 EKEGNLVGWIRGLVRKNQVSRAIDPKIHDTGPEKQMEEALKIGYLCTADLPLKRPSMQQI 181 E+E NLV W+RGLVRKNQ S+AIDPKI DTGP+ QMEEALKIGYLCTAD+P KRPSMQQI Sbjct: 781 EQETNLVSWVRGLVRKNQGSKAIDPKIRDTGPDYQMEEALKIGYLCTADIPSKRPSMQQI 840 Query: 182 VGLLKDVE 205 VGLLKD+E Sbjct: 841 VGLLKDIE 848 >XP_016683142.1 PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g24230 [Gossypium hirsutum] Length = 853 Score = 118 bits (296), Expect = 1e-28 Identities = 56/68 (82%), Positives = 62/68 (91%) Frame = +2 Query: 2 EKEGNLVGWIRGLVRKNQVSRAIDPKIHDTGPEKQMEEALKIGYLCTADLPLKRPSMQQI 181 E+E NLV W+RGLVRKNQ S+AIDPKI DTGP+ QMEEALKIGYLCTAD+P KRPSMQQI Sbjct: 781 EQETNLVSWVRGLVRKNQGSKAIDPKIRDTGPDYQMEEALKIGYLCTADIPSKRPSMQQI 840 Query: 182 VGLLKDVE 205 VGLLKD+E Sbjct: 841 VGLLKDIE 848 >XP_016754932.1 PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g24230 [Gossypium hirsutum] Length = 853 Score = 118 bits (296), Expect = 1e-28 Identities = 56/68 (82%), Positives = 62/68 (91%) Frame = +2 Query: 2 EKEGNLVGWIRGLVRKNQVSRAIDPKIHDTGPEKQMEEALKIGYLCTADLPLKRPSMQQI 181 E+E NLV W+RGLVRKNQ S+AIDPKI DTGP+ QMEEALKIGYLCTAD+P KRPSMQQI Sbjct: 781 EQETNLVSWVRGLVRKNQGSKAIDPKIRDTGPDYQMEEALKIGYLCTADIPSKRPSMQQI 840 Query: 182 VGLLKDVE 205 VGLLKD+E Sbjct: 841 VGLLKDIE 848