BLASTX nr result
ID: Phellodendron21_contig00035683
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00035683 (263 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006431891.1 hypothetical protein CICLE_v10000890mg [Citrus cl... 53 3e-06 >XP_006431891.1 hypothetical protein CICLE_v10000890mg [Citrus clementina] ESR45131.1 hypothetical protein CICLE_v10000890mg [Citrus clementina] Length = 515 Score = 53.1 bits (126), Expect = 3e-06 Identities = 29/53 (54%), Positives = 33/53 (62%) Frame = -1 Query: 161 KKKLFPDALSMGKNEXXXXXXXXXXXXXXXXSRFLCARCSLVLSLITKEFSLK 3 +K+ PDALSMGKNE SRF CARCS+VLSLI+KE SLK Sbjct: 12 EKRSTPDALSMGKNEQNLQQQQTSHTPDQRSSRFFCARCSVVLSLISKELSLK 64