BLASTX nr result
ID: Phellodendron21_contig00035510
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00035510 (271 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAL01113.1 hypothetical protein IQ06DRAFT_293239 [Stagonospora s... 83 4e-19 XP_018382440.1 hypothetical protein CC77DRAFT_1034003 [Alternari... 73 3e-15 OCK95773.1 hypothetical protein K441DRAFT_555724 [Cenococcum geo... 70 4e-14 XP_001932528.1 hypothetical protein PTRG_02195 [Pyrenophora trit... 69 1e-13 OCK79427.1 hypothetical protein K432DRAFT_299854 [Lepidopterella... 67 1e-12 OCL05131.1 hypothetical protein AOQ84DRAFT_299512 [Glonium stell... 66 1e-12 XP_007683905.1 hypothetical protein COCMIDRAFT_55876, partial [B... 66 2e-12 XP_007583042.1 hypothetical protein UCRNP2_3751 [Neofusicoccum p... 65 5e-12 XP_008027074.1 hypothetical protein SETTUDRAFT_41935 [Setosphaer... 62 2e-10 CRG87171.1 hypothetical protein PISL3812_04188 [Talaromyces isla... 56 1e-08 XP_003845551.1 hypothetical protein LEMA_P008590.1 [Leptosphaeri... 55 3e-08 XP_002145500.1 hypothetical protein PMAA_037680 [Talaromyces mar... 54 1e-07 OJJ58283.1 hypothetical protein ASPSYDRAFT_1045764 [Aspergillus ... 53 2e-07 OJJ02140.1 hypothetical protein ASPVEDRAFT_52887 [Aspergillus ve... 53 2e-07 XP_002487036.1 hypothetical protein TSTA_054360 [Talaromyces sti... 53 3e-07 GAM34975.1 hypothetical protein TCE0_015f02909 [Talaromyces cell... 52 5e-07 KZZ86687.1 hypothetical protein AAP_06306 [Ascosphaera apis ARSE... 52 8e-07 XP_002793406.1 hypothetical protein PAAG_04935 [Paracoccidioides... 50 2e-06 EPS34703.1 hypothetical protein PDE_09667 [Penicillium oxalicum ... 50 2e-06 CEL00509.1 hypothetical protein ASPCAL00109 [Aspergillus calidou... 50 2e-06 >OAL01113.1 hypothetical protein IQ06DRAFT_293239 [Stagonospora sp. SRC1lsM3a] Length = 72 Score = 82.8 bits (203), Expect = 4e-19 Identities = 38/54 (70%), Positives = 40/54 (74%) Frame = +2 Query: 110 MFSCANYERGCRGRCNASNGRCDSCVVLNLQXXXXXXXXXXXXXNGRPAAAYSA 271 MFSCANYERGCRGRCN +NGRCDSCVVLNLQ +GRPAAAYSA Sbjct: 1 MFSCANYERGCRGRCNTTNGRCDSCVVLNLQSTRSNSASSVSSTSGRPAAAYSA 54 >XP_018382440.1 hypothetical protein CC77DRAFT_1034003 [Alternaria alternata] OAG17019.1 hypothetical protein CC77DRAFT_1034003 [Alternaria alternata] Length = 74 Score = 73.2 bits (178), Expect = 3e-15 Identities = 36/54 (66%), Positives = 37/54 (68%) Frame = +2 Query: 110 MFSCANYERGCRGRCNASNGRCDSCVVLNLQXXXXXXXXXXXXXNGRPAAAYSA 271 MFSCANYERGCRGRCNA NGRCDSC LNLQ NG P+AAYSA Sbjct: 1 MFSCANYERGCRGRCNAMNGRCDSCHTLNLQ-VRSNSASSTSSTNGLPSAAYSA 53 >OCK95773.1 hypothetical protein K441DRAFT_555724 [Cenococcum geophilum 1.58] Length = 71 Score = 70.1 bits (170), Expect = 4e-14 Identities = 32/54 (59%), Positives = 32/54 (59%) Frame = +2 Query: 110 MFSCANYERGCRGRCNASNGRCDSCVVLNLQXXXXXXXXXXXXXNGRPAAAYSA 271 MFSC NYERGCRGRCN NGRCDSCV LNLQ N A YSA Sbjct: 1 MFSCVNYERGCRGRCNQQNGRCDSCVTLNLQQVRTPSSSSISSINSTSGATYSA 54 >XP_001932528.1 hypothetical protein PTRG_02195 [Pyrenophora tritici-repentis Pt-1C-BFP] EDU41633.1 hypothetical protein PTRG_02195 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 72 Score = 68.9 bits (167), Expect = 1e-13 Identities = 34/54 (62%), Positives = 35/54 (64%) Frame = +2 Query: 110 MFSCANYERGCRGRCNASNGRCDSCVVLNLQXXXXXXXXXXXXXNGRPAAAYSA 271 MFSCANYERGCRGRCN NGRCDSC LNLQ N P+AAYSA Sbjct: 1 MFSCANYERGCRGRCNRMNGRCDSCHTLNLQ-VRSNSSSSASSVNSLPSAAYSA 53 >OCK79427.1 hypothetical protein K432DRAFT_299854 [Lepidopterella palustris CBS 459.81] Length = 72 Score = 66.6 bits (161), Expect = 1e-12 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = +2 Query: 110 MFSCANYERGCRGRCNASNGRCDSCVVLNLQ 202 MFSC NYERGCRGRCN NGRCDSCV LNLQ Sbjct: 1 MFSCVNYERGCRGRCNTQNGRCDSCVTLNLQ 31 >OCL05131.1 hypothetical protein AOQ84DRAFT_299512 [Glonium stellatum] Length = 72 Score = 66.2 bits (160), Expect = 1e-12 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = +2 Query: 110 MFSCANYERGCRGRCNASNGRCDSCVVLNLQ 202 MFSC NYERGCRGRCN NGRCDSCV LNLQ Sbjct: 1 MFSCVNYERGCRGRCNQQNGRCDSCVTLNLQ 31 >XP_007683905.1 hypothetical protein COCMIDRAFT_55876, partial [Bipolaris oryzae ATCC 44560] XP_007697642.1 hypothetical protein COCSADRAFT_57223, partial [Bipolaris sorokiniana ND90Pr] XP_007707763.1 hypothetical protein COCCADRAFT_50062, partial [Bipolaris zeicola 26-R-13] XP_014078123.1 hypothetical protein COCC4DRAFT_119685, partial [Bipolaris maydis ATCC 48331] XP_014556550.1 hypothetical protein COCVIDRAFT_57968, partial [Bipolaris victoriae FI3] EMD66739.1 hypothetical protein COCSADRAFT_57223, partial [Bipolaris sorokiniana ND90Pr] EMD97329.1 hypothetical protein COCHEDRAFT_1070403, partial [Bipolaris maydis C5] ENI04214.1 hypothetical protein COCC4DRAFT_119685, partial [Bipolaris maydis ATCC 48331] EUC38014.1 hypothetical protein COCCADRAFT_50062, partial [Bipolaris zeicola 26-R-13] EUC49608.1 hypothetical protein COCMIDRAFT_55876, partial [Bipolaris oryzae ATCC 44560] EUN26952.1 hypothetical protein COCVIDRAFT_57968, partial [Bipolaris victoriae FI3] Length = 69 Score = 65.9 bits (159), Expect = 2e-12 Identities = 33/54 (61%), Positives = 34/54 (62%) Frame = +2 Query: 110 MFSCANYERGCRGRCNASNGRCDSCVVLNLQXXXXXXXXXXXXXNGRPAAAYSA 271 MFSCANYERGCRGRCN N RCDSC LNLQ N P+AAYSA Sbjct: 1 MFSCANYERGCRGRCNRLNDRCDSCHTLNLQ-VRSNSASSTSSTNALPSAAYSA 53 >XP_007583042.1 hypothetical protein UCRNP2_3751 [Neofusicoccum parvum UCRNP2] EOD49450.1 hypothetical protein UCRNP2_3751 [Neofusicoccum parvum UCRNP2] Length = 67 Score = 64.7 bits (156), Expect = 5e-12 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 110 MFSCANYERGCRGRCNASNGRCDSCVVLNLQ 202 MFSCANYERGCRGRCN+ NGRC SC+ LNLQ Sbjct: 1 MFSCANYERGCRGRCNSPNGRCASCITLNLQ 31 >XP_008027074.1 hypothetical protein SETTUDRAFT_41935 [Setosphaeria turcica Et28A] EOA84687.1 hypothetical protein SETTUDRAFT_41935 [Setosphaeria turcica Et28A] Length = 110 Score = 61.6 bits (148), Expect = 2e-10 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = +2 Query: 110 MFSCANYERGCRGRCNASNGRCDSCVVLNLQ 202 MFSCANYERGCRGRCN N RCDSC LNLQ Sbjct: 1 MFSCANYERGCRGRCNRLNDRCDSCHTLNLQ 31 >CRG87171.1 hypothetical protein PISL3812_04188 [Talaromyces islandicus] Length = 66 Score = 56.2 bits (134), Expect = 1e-08 Identities = 21/31 (67%), Positives = 25/31 (80%) Frame = +2 Query: 110 MFSCANYERGCRGRCNASNGRCDSCVVLNLQ 202 M+SCANY RGCRGRCN G+C+ C VLNL+ Sbjct: 1 MYSCANYPRGCRGRCNTQGGKCNDCTVLNLR 31 >XP_003845551.1 hypothetical protein LEMA_P008590.1 [Leptosphaeria maculans JN3] CBY02072.1 hypothetical protein LEMA_P008590.1 [Leptosphaeria maculans JN3] Length = 74 Score = 55.5 bits (132), Expect = 3e-08 Identities = 26/54 (48%), Positives = 29/54 (53%) Frame = +2 Query: 110 MFSCANYERGCRGRCNASNGRCDSCVVLNLQXXXXXXXXXXXXXNGRPAAAYSA 271 MFSC NYERGCRGR N + RCDSCV LN+ + AYSA Sbjct: 1 MFSCVNYERGCRGRANNTAARCDSCVTLNISSRSNSASSTSSSSSRSSQTAYSA 54 >XP_002145500.1 hypothetical protein PMAA_037680 [Talaromyces marneffei ATCC 18224] EEA28985.1 hypothetical protein PMAA_037680 [Talaromyces marneffei ATCC 18224] Length = 68 Score = 53.5 bits (127), Expect = 1e-07 Identities = 20/31 (64%), Positives = 23/31 (74%) Frame = +2 Query: 110 MFSCANYERGCRGRCNASNGRCDSCVVLNLQ 202 M+SC+NY RGCRGRCN G+C C LNLQ Sbjct: 1 MYSCSNYPRGCRGRCNIQGGKCSDCTSLNLQ 31 >OJJ58283.1 hypothetical protein ASPSYDRAFT_1045764 [Aspergillus sydowii CBS 593.65] Length = 68 Score = 53.1 bits (126), Expect = 2e-07 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = +2 Query: 110 MFSCANYERGCRGRCNASNGRCDSCVVLNLQ 202 MFSCANY RGCRGR N S G+C CV LNL+ Sbjct: 1 MFSCANYPRGCRGRVNISGGKCPDCVQLNLR 31 >OJJ02140.1 hypothetical protein ASPVEDRAFT_52887 [Aspergillus versicolor CBS 583.65] Length = 68 Score = 53.1 bits (126), Expect = 2e-07 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = +2 Query: 110 MFSCANYERGCRGRCNASNGRCDSCVVLNLQ 202 MFSCANY RGCRGR N S G+C CV LNL+ Sbjct: 1 MFSCANYPRGCRGRVNISGGKCPDCVQLNLR 31 >XP_002487036.1 hypothetical protein TSTA_054360 [Talaromyces stipitatus ATCC 10500] EED12925.1 hypothetical protein TSTA_054360 [Talaromyces stipitatus ATCC 10500] Length = 68 Score = 52.8 bits (125), Expect = 3e-07 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = +2 Query: 110 MFSCANYERGCRGRCNASNGRCDSCVVLNLQ 202 M+SC+NY RGCRGRCN G+C C LNL+ Sbjct: 1 MYSCSNYPRGCRGRCNIQGGKCSDCTALNLR 31 >GAM34975.1 hypothetical protein TCE0_015f02909 [Talaromyces cellulolyticus] Length = 68 Score = 52.0 bits (123), Expect = 5e-07 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = +2 Query: 110 MFSCANYERGCRGRCNASNGRCDSCVVLNLQ 202 M+SC+NY RGCRGRCN G+C C LNL+ Sbjct: 1 MYSCSNYPRGCRGRCNIQGGKCSDCTSLNLR 31 >KZZ86687.1 hypothetical protein AAP_06306 [Ascosphaera apis ARSEF 7405] Length = 70 Score = 51.6 bits (122), Expect = 8e-07 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = +2 Query: 110 MFSCANYERGCRGRCNASNGRCDSCVVLNLQ 202 M+SCANY RGCRGRCN GRC+ C + L+ Sbjct: 1 MYSCANYPRGCRGRCNVPGGRCEDCKIQKLR 31 >XP_002793406.1 hypothetical protein PAAG_04935 [Paracoccidioides lutzii Pb01] XP_010758561.1 hypothetical protein PADG_02671 [Paracoccidioides brasiliensis Pb18] EEH17701.1 hypothetical protein PABG_00264 [Paracoccidioides brasiliensis Pb03] EEH33886.1 hypothetical protein PAAG_04935 [Paracoccidioides lutzii Pb01] EEH46573.1 hypothetical protein PADG_02671 [Paracoccidioides brasiliensis Pb18] ODH46333.1 hypothetical protein GX48_07566 [Paracoccidioides brasiliensis] Length = 66 Score = 50.4 bits (119), Expect = 2e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = +2 Query: 110 MFSCANYERGCRGRCNASNGRCDSCVVLNLQ 202 M+SCANY RGCRGR N GRC CV NL+ Sbjct: 1 MYSCANYPRGCRGRVNTEGGRCADCVTANLR 31 >EPS34703.1 hypothetical protein PDE_09667 [Penicillium oxalicum 114-2] Length = 66 Score = 50.4 bits (119), Expect = 2e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = +2 Query: 110 MFSCANYERGCRGRCNASNGRCDSCVVLNLQ 202 MFSCANY RGCRGR N +C CV LNL+ Sbjct: 1 MFSCANYPRGCRGRVNRDGAKCSDCVTLNLR 31 >CEL00509.1 hypothetical protein ASPCAL00109 [Aspergillus calidoustus] Length = 67 Score = 50.4 bits (119), Expect = 2e-06 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = +2 Query: 110 MFSCANYERGCRGRCNASNGRCDSCVVLNLQ 202 MFSCANY RGCRGR N +C CV LNL+ Sbjct: 1 MFSCANYPRGCRGRANQQGAKCPDCVTLNLR 31