BLASTX nr result
ID: Phellodendron21_contig00035496
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00035496 (304 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVI07437.1 Cyclophilin-like peptidyl-prolyl cis-trans isomerase ... 112 2e-29 XP_018824166.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 112 3e-29 XP_010041670.2 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 112 5e-29 XP_010043280.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 112 5e-29 XP_010041672.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 111 6e-29 XP_010043279.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 112 9e-29 ANA12002.1 cyclophilin [Panax ginseng] 110 1e-28 XP_010660113.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 110 1e-28 OAY42044.1 hypothetical protein MANES_09G149200 [Manihot esculenta] 110 2e-28 XP_010274820.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 109 2e-28 XP_015875370.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 109 2e-28 XP_006442714.1 hypothetical protein CICLE_v10022535mg [Citrus cl... 109 2e-28 XP_006487732.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 109 3e-28 GAV66787.1 Pro_isomerase domain-containing protein [Cephalotus f... 108 5e-28 XP_019433438.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 108 5e-28 XP_015968436.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 108 5e-28 XP_010539096.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 108 5e-28 XP_016205351.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 108 7e-28 KMZ56119.1 Peptidyl-prolyl cis-trans isomerase [Zostera marina] 108 1e-27 XP_011036276.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CY... 107 1e-27 >KVI07437.1 Cyclophilin-like peptidyl-prolyl cis-trans isomerase domain-containing protein [Cynara cardunculus var. scolymus] Length = 174 Score = 112 bits (280), Expect = 2e-29 Identities = 53/56 (94%), Positives = 55/56 (98%) Frame = -1 Query: 169 MSNPKVFFDILIGQMKKGRVVMELFADVTPKTAENFRALCTGEKGIGASGKPLHYK 2 MSNPKVFFDILIG+MK GRVVMELFADVTPKTAENFRALCTGEKG+GASGKPLHYK Sbjct: 1 MSNPKVFFDILIGKMKAGRVVMELFADVTPKTAENFRALCTGEKGLGASGKPLHYK 56 >XP_018824166.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3 [Juglans regia] Length = 174 Score = 112 bits (279), Expect = 3e-29 Identities = 53/56 (94%), Positives = 55/56 (98%) Frame = -1 Query: 169 MSNPKVFFDILIGQMKKGRVVMELFADVTPKTAENFRALCTGEKGIGASGKPLHYK 2 MSNPKVFFDILIG+MK GRVVMELFADVTPKTAENFRALCTGEKGIG+SGKPLHYK Sbjct: 1 MSNPKVFFDILIGKMKAGRVVMELFADVTPKTAENFRALCTGEKGIGSSGKPLHYK 56 >XP_010041670.2 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3 isoform X1 [Eucalyptus grandis] Length = 190 Score = 112 bits (279), Expect = 5e-29 Identities = 53/57 (92%), Positives = 55/57 (96%) Frame = -1 Query: 172 KMSNPKVFFDILIGQMKKGRVVMELFADVTPKTAENFRALCTGEKGIGASGKPLHYK 2 +MSNPKVFFDILIG+MK GRVVMELFADVTPKTAENFRALCTGEKGIG SGKPLHYK Sbjct: 16 RMSNPKVFFDILIGKMKAGRVVMELFADVTPKTAENFRALCTGEKGIGRSGKPLHYK 72 >XP_010043280.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3 isoform X2 [Eucalyptus grandis] Length = 190 Score = 112 bits (279), Expect = 5e-29 Identities = 53/57 (92%), Positives = 55/57 (96%) Frame = -1 Query: 172 KMSNPKVFFDILIGQMKKGRVVMELFADVTPKTAENFRALCTGEKGIGASGKPLHYK 2 +MSNPKVFFDILIG+MK GRVVMELFADVTPKTAENFRALCTGEKGIG SGKPLHYK Sbjct: 16 RMSNPKVFFDILIGKMKAGRVVMELFADVTPKTAENFRALCTGEKGIGRSGKPLHYK 72 >XP_010041672.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3 isoform X2 [Eucalyptus grandis] XP_018722734.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3 isoform X2 [Eucalyptus grandis] KCW44182.1 hypothetical protein EUGRSUZ_L02398 [Eucalyptus grandis] KCW44183.1 hypothetical protein EUGRSUZ_L02398 [Eucalyptus grandis] KCW85293.1 hypothetical protein EUGRSUZ_B02135 [Eucalyptus grandis] Length = 174 Score = 111 bits (277), Expect = 6e-29 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = -1 Query: 169 MSNPKVFFDILIGQMKKGRVVMELFADVTPKTAENFRALCTGEKGIGASGKPLHYK 2 MSNPKVFFDILIG+MK GRVVMELFADVTPKTAENFRALCTGEKGIG SGKPLHYK Sbjct: 1 MSNPKVFFDILIGKMKAGRVVMELFADVTPKTAENFRALCTGEKGIGRSGKPLHYK 56 >XP_010043279.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3 isoform X1 [Eucalyptus grandis] Length = 217 Score = 112 bits (279), Expect = 9e-29 Identities = 53/57 (92%), Positives = 55/57 (96%) Frame = -1 Query: 172 KMSNPKVFFDILIGQMKKGRVVMELFADVTPKTAENFRALCTGEKGIGASGKPLHYK 2 +MSNPKVFFDILIG+MK GRVVMELFADVTPKTAENFRALCTGEKGIG SGKPLHYK Sbjct: 43 RMSNPKVFFDILIGKMKAGRVVMELFADVTPKTAENFRALCTGEKGIGRSGKPLHYK 99 >ANA12002.1 cyclophilin [Panax ginseng] Length = 174 Score = 110 bits (275), Expect = 1e-28 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = -1 Query: 169 MSNPKVFFDILIGQMKKGRVVMELFADVTPKTAENFRALCTGEKGIGASGKPLHYK 2 M+NPKVFFDILIG+MK GRVVMELFADVTPKTAENFRALCTGEKGIG SGKPLHYK Sbjct: 1 MANPKVFFDILIGKMKAGRVVMELFADVTPKTAENFRALCTGEKGIGVSGKPLHYK 56 >XP_010660113.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3 [Vitis vinifera] CAN61038.1 hypothetical protein VITISV_041753 [Vitis vinifera] Length = 174 Score = 110 bits (275), Expect = 1e-28 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = -1 Query: 169 MSNPKVFFDILIGQMKKGRVVMELFADVTPKTAENFRALCTGEKGIGASGKPLHYK 2 MSNPKVFFDIL+G+MK GR+VMELFADVTPKTAENFRALCTGEKGIG SGKPLHYK Sbjct: 1 MSNPKVFFDILVGKMKAGRIVMELFADVTPKTAENFRALCTGEKGIGMSGKPLHYK 56 >OAY42044.1 hypothetical protein MANES_09G149200 [Manihot esculenta] Length = 174 Score = 110 bits (274), Expect = 2e-28 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = -1 Query: 169 MSNPKVFFDILIGQMKKGRVVMELFADVTPKTAENFRALCTGEKGIGASGKPLHYK 2 MSNPKVFFDILIG+MK GR+VMELFADVTPKTAENFRALCTGEKG+G SGKPLHYK Sbjct: 1 MSNPKVFFDILIGKMKAGRIVMELFADVTPKTAENFRALCTGEKGLGRSGKPLHYK 56 >XP_010274820.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3 [Nelumbo nucifera] Length = 174 Score = 109 bits (273), Expect = 2e-28 Identities = 52/56 (92%), Positives = 53/56 (94%) Frame = -1 Query: 169 MSNPKVFFDILIGQMKKGRVVMELFADVTPKTAENFRALCTGEKGIGASGKPLHYK 2 MSNPKVFFDILIG+MK GRVVMELFADVTPKTAENFR LCTGEKGIG SGKPLHYK Sbjct: 1 MSNPKVFFDILIGKMKAGRVVMELFADVTPKTAENFRCLCTGEKGIGISGKPLHYK 56 >XP_015875370.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3 [Ziziphus jujuba] ACG70968.1 cyclophilin [Ziziphus jujuba] Length = 174 Score = 109 bits (273), Expect = 2e-28 Identities = 52/56 (92%), Positives = 53/56 (94%) Frame = -1 Query: 169 MSNPKVFFDILIGQMKKGRVVMELFADVTPKTAENFRALCTGEKGIGASGKPLHYK 2 MSNPKVFFDILIG+MK GRVVMELFADVTPKTAENFR LCTGEKGIG SGKPLHYK Sbjct: 1 MSNPKVFFDILIGKMKAGRVVMELFADVTPKTAENFRVLCTGEKGIGISGKPLHYK 56 >XP_006442714.1 hypothetical protein CICLE_v10022535mg [Citrus clementina] ESR55954.1 hypothetical protein CICLE_v10022535mg [Citrus clementina] Length = 174 Score = 109 bits (273), Expect = 2e-28 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = -1 Query: 169 MSNPKVFFDILIGQMKKGRVVMELFADVTPKTAENFRALCTGEKGIGASGKPLHYK 2 M+NP+VFFDILIG+M KGRVVMELFADVTPKTAENFRALCTGEKGIG SGKPLHYK Sbjct: 1 MTNPRVFFDILIGKMNKGRVVMELFADVTPKTAENFRALCTGEKGIGTSGKPLHYK 56 >XP_006487732.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3 [Citrus sinensis] KDO50002.1 hypothetical protein CISIN_1g030603mg [Citrus sinensis] Length = 174 Score = 109 bits (272), Expect = 3e-28 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = -1 Query: 169 MSNPKVFFDILIGQMKKGRVVMELFADVTPKTAENFRALCTGEKGIGASGKPLHYK 2 M+NP+VFFDILIG+M KGRVVMELFADVTPKTAENFRALCTGEKGIG SGKPLHYK Sbjct: 1 MTNPRVFFDILIGKMNKGRVVMELFADVTPKTAENFRALCTGEKGIGMSGKPLHYK 56 >GAV66787.1 Pro_isomerase domain-containing protein [Cephalotus follicularis] Length = 174 Score = 108 bits (271), Expect = 5e-28 Identities = 50/56 (89%), Positives = 54/56 (96%) Frame = -1 Query: 169 MSNPKVFFDILIGQMKKGRVVMELFADVTPKTAENFRALCTGEKGIGASGKPLHYK 2 MSNPKVFFDILIG+MK GR+VMELFAD TPKTAENFRALCTGE+GIG+SGKPLHYK Sbjct: 1 MSNPKVFFDILIGKMKAGRIVMELFADATPKTAENFRALCTGERGIGSSGKPLHYK 56 >XP_019433438.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3 [Lupinus angustifolius] OIW21623.1 hypothetical protein TanjilG_06776 [Lupinus angustifolius] Length = 174 Score = 108 bits (271), Expect = 5e-28 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = -1 Query: 169 MSNPKVFFDILIGQMKKGRVVMELFADVTPKTAENFRALCTGEKGIGASGKPLHYK 2 MSNPKVFFDILIG++K GRVVMELFADVTPKTAENFRALCTGEKGIG +GKPLHYK Sbjct: 1 MSNPKVFFDILIGKLKAGRVVMELFADVTPKTAENFRALCTGEKGIGRAGKPLHYK 56 >XP_015968436.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3-like [Arachis duranensis] Length = 174 Score = 108 bits (271), Expect = 5e-28 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -1 Query: 169 MSNPKVFFDILIGQMKKGRVVMELFADVTPKTAENFRALCTGEKGIGASGKPLHYK 2 MSNPKVFFDI IG+MK GR+VMELFADVTPKTAENFRALCTGEKGIG SGKPLHYK Sbjct: 1 MSNPKVFFDIAIGRMKAGRIVMELFADVTPKTAENFRALCTGEKGIGKSGKPLHYK 56 >XP_010539096.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3 [Tarenaya hassleriana] Length = 174 Score = 108 bits (271), Expect = 5e-28 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = -1 Query: 169 MSNPKVFFDILIGQMKKGRVVMELFADVTPKTAENFRALCTGEKGIGASGKPLHYK 2 MSNP+VFFDILIG+MK GRVVMELFADVTPKTAENFRALCTGEKGIG +GKPLHYK Sbjct: 1 MSNPRVFFDILIGKMKAGRVVMELFADVTPKTAENFRALCTGEKGIGRAGKPLHYK 56 >XP_016205351.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3-like [Arachis ipaensis] Length = 174 Score = 108 bits (270), Expect = 7e-28 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -1 Query: 169 MSNPKVFFDILIGQMKKGRVVMELFADVTPKTAENFRALCTGEKGIGASGKPLHYK 2 MSNPKVFFDI IG+MK GR+VMELFADVTPKTAENFRALCTGEKGIG SGKPLHYK Sbjct: 1 MSNPKVFFDIAIGRMKAGRIVMELFADVTPKTAENFRALCTGEKGIGNSGKPLHYK 56 >KMZ56119.1 Peptidyl-prolyl cis-trans isomerase [Zostera marina] Length = 174 Score = 108 bits (269), Expect = 1e-27 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -1 Query: 169 MSNPKVFFDILIGQMKKGRVVMELFADVTPKTAENFRALCTGEKGIGASGKPLHYK 2 MSNPKVFFDILIG+ K GRVVMELFADVTPKTAENFRALCTGEKGIG SGKP+HYK Sbjct: 1 MSNPKVFFDILIGRAKAGRVVMELFADVTPKTAENFRALCTGEKGIGQSGKPMHYK 56 >XP_011036276.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3 [Populus euphratica] XP_011004768.1 PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3 [Populus euphratica] Length = 174 Score = 107 bits (268), Expect = 1e-27 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = -1 Query: 169 MSNPKVFFDILIGQMKKGRVVMELFADVTPKTAENFRALCTGEKGIGASGKPLHYK 2 MSNPKVFFDILIG+MK GR+VMELFAD TPKTAENFRALCTGEKGIG +GKPLHYK Sbjct: 1 MSNPKVFFDILIGKMKAGRIVMELFADATPKTAENFRALCTGEKGIGNAGKPLHYK 56