BLASTX nr result
ID: Phellodendron21_contig00035492
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00035492 (384 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003322014.2 hypothetical protein PGTG_03551 [Puccinia gramini... 83 6e-19 KNZ48863.1 hypothetical protein VP01_535g5 [Puccinia sorghi] 81 5e-18 KNF00822.1 hypothetical protein PSTG_05956 [Puccinia striiformis... 78 7e-16 >XP_003322014.2 hypothetical protein PGTG_03551 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP77595.2 hypothetical protein PGTG_03551 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 48 Score = 83.2 bits (204), Expect = 6e-19 Identities = 36/47 (76%), Positives = 44/47 (93%) Frame = -2 Query: 338 MFSGQPAPSPAQIALARVEARRTLKGFVYTVITIRALPFVFDLLSSW 198 MF+GQPAPSPAQIALA+ +ARRT+KGFVYT++TIRA+PFVFD + SW Sbjct: 1 MFAGQPAPSPAQIALAQADARRTMKGFVYTILTIRAIPFVFDYIGSW 47 >KNZ48863.1 hypothetical protein VP01_535g5 [Puccinia sorghi] Length = 49 Score = 80.9 bits (198), Expect = 5e-18 Identities = 38/48 (79%), Positives = 44/48 (91%), Gaps = 1/48 (2%) Frame = -2 Query: 338 MFSG-QPAPSPAQIALARVEARRTLKGFVYTVITIRALPFVFDLLSSW 198 MFSG QPAPSPAQIALA+ EARRT+KGFVYT++TIRA+PFVFD + SW Sbjct: 1 MFSGGQPAPSPAQIALAQAEARRTMKGFVYTILTIRAIPFVFDYIGSW 48 >KNF00822.1 hypothetical protein PSTG_05956 [Puccinia striiformis f. sp. tritici PST-78] Length = 131 Score = 77.8 bits (190), Expect = 7e-16 Identities = 37/48 (77%), Positives = 43/48 (89%), Gaps = 1/48 (2%) Frame = -2 Query: 338 MFSG-QPAPSPAQIALARVEARRTLKGFVYTVITIRALPFVFDLLSSW 198 MFSG Q APSPAQIALA+ EARRT+KGFVYT++TIRA+PFVFD + SW Sbjct: 83 MFSGAQQAPSPAQIALAQAEARRTMKGFVYTILTIRAIPFVFDYIGSW 130