BLASTX nr result
ID: Phellodendron21_contig00035488
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00035488 (366 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006446305.1 hypothetical protein CICLE_v100144561mg, partial ... 84 5e-18 KDO54786.1 hypothetical protein CISIN_1g004976mg [Citrus sinensis] 84 3e-16 XP_006470533.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 3e-16 XP_016646873.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 4e-13 XP_007226735.1 hypothetical protein PRUPE_ppa019161mg [Prunus pe... 74 4e-13 ONI35635.1 hypothetical protein PRUPE_1G547200 [Prunus persica] ... 74 4e-13 XP_008219082.2 PREDICTED: pentatricopeptide repeat-containing pr... 74 4e-13 XP_009379032.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 8e-13 XP_008378727.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 8e-13 XP_003623229.2 TCP-1/cpn60 chaperonin family protein [Medicago t... 72 3e-12 XP_015873656.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 5e-12 GAV62124.1 PPR domain-containing protein/PPR_1 domain-containing... 70 2e-11 XP_015082055.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 5e-11 XP_006346263.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 5e-11 XP_004244115.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 5e-11 GAU35669.1 hypothetical protein TSUD_162400 [Trifolium subterran... 68 9e-11 XP_004492420.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 2e-10 XP_016464226.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 2e-10 EYU46193.1 hypothetical protein MIMGU_mgv1a026384mg [Erythranthe... 67 2e-10 XP_012853570.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 2e-10 >XP_006446305.1 hypothetical protein CICLE_v100144561mg, partial [Citrus clementina] ESR59545.1 hypothetical protein CICLE_v100144561mg, partial [Citrus clementina] Length = 162 Score = 84.0 bits (206), Expect = 5e-18 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = +1 Query: 1 VVLDQELTSTILICLCNVSEDLDMAKLLPTFSQKMSEGKSISCNKLLLKLR 153 V LDQELTSTILICLCN+SEDLD+AKL PTFSQ+ S+GKSISC LLLKL+ Sbjct: 101 VHLDQELTSTILICLCNISEDLDVAKLFPTFSQETSKGKSISCKDLLLKLQ 151 >KDO54786.1 hypothetical protein CISIN_1g004976mg [Citrus sinensis] Length = 721 Score = 83.6 bits (205), Expect = 3e-16 Identities = 40/51 (78%), Positives = 46/51 (90%) Frame = +1 Query: 1 VVLDQELTSTILICLCNVSEDLDMAKLLPTFSQKMSEGKSISCNKLLLKLR 153 V LDQELTSTIL+CLCN+SEDLD+AKL PTFSQ+ S+GKSISC LLLKL+ Sbjct: 660 VHLDQELTSTILVCLCNISEDLDVAKLFPTFSQETSKGKSISCKDLLLKLQ 710 >XP_006470533.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Citrus sinensis] XP_006470534.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Citrus sinensis] Length = 721 Score = 83.6 bits (205), Expect = 3e-16 Identities = 40/51 (78%), Positives = 46/51 (90%) Frame = +1 Query: 1 VVLDQELTSTILICLCNVSEDLDMAKLLPTFSQKMSEGKSISCNKLLLKLR 153 V LDQELTSTIL+CLCN+SEDLD+AKL PTFSQ+ S+GKSISC LLLKL+ Sbjct: 660 VHLDQELTSTILVCLCNISEDLDVAKLFPTFSQETSKGKSISCKDLLLKLQ 710 >XP_016646873.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like isoform X2 [Prunus mume] Length = 626 Score = 74.3 bits (181), Expect = 4e-13 Identities = 33/50 (66%), Positives = 43/50 (86%) Frame = +1 Query: 1 VVLDQELTSTILICLCNVSEDLDMAKLLPTFSQKMSEGKSISCNKLLLKL 150 V+LD E+TSTIL CLC +S+D D+ K+LPTFSQ+ S+G SISCN+LL+KL Sbjct: 568 VILDSEITSTILSCLCQISDDYDVMKILPTFSQETSKGASISCNELLMKL 617 >XP_007226735.1 hypothetical protein PRUPE_ppa019161mg [Prunus persica] ONI35640.1 hypothetical protein PRUPE_1G547200 [Prunus persica] ONI35641.1 hypothetical protein PRUPE_1G547200 [Prunus persica] ONI35642.1 hypothetical protein PRUPE_1G547200 [Prunus persica] ONI35643.1 hypothetical protein PRUPE_1G547200 [Prunus persica] ONI35644.1 hypothetical protein PRUPE_1G547200 [Prunus persica] ONI35645.1 hypothetical protein PRUPE_1G547200 [Prunus persica] ONI35646.1 hypothetical protein PRUPE_1G547200 [Prunus persica] Length = 626 Score = 74.3 bits (181), Expect = 4e-13 Identities = 33/50 (66%), Positives = 43/50 (86%) Frame = +1 Query: 1 VVLDQELTSTILICLCNVSEDLDMAKLLPTFSQKMSEGKSISCNKLLLKL 150 V+LD E+TSTIL CLC +S+D D+ K+LPTFSQ+ S+G SISCN+LL+KL Sbjct: 568 VILDSEITSTILSCLCQISDDYDVMKILPTFSQETSKGASISCNELLMKL 617 >ONI35635.1 hypothetical protein PRUPE_1G547200 [Prunus persica] ONI35636.1 hypothetical protein PRUPE_1G547200 [Prunus persica] ONI35637.1 hypothetical protein PRUPE_1G547200 [Prunus persica] ONI35638.1 hypothetical protein PRUPE_1G547200 [Prunus persica] ONI35639.1 hypothetical protein PRUPE_1G547200 [Prunus persica] Length = 724 Score = 74.3 bits (181), Expect = 4e-13 Identities = 33/50 (66%), Positives = 43/50 (86%) Frame = +1 Query: 1 VVLDQELTSTILICLCNVSEDLDMAKLLPTFSQKMSEGKSISCNKLLLKL 150 V+LD E+TSTIL CLC +S+D D+ K+LPTFSQ+ S+G SISCN+LL+KL Sbjct: 666 VILDSEITSTILSCLCQISDDYDVMKILPTFSQETSKGASISCNELLMKL 715 >XP_008219082.2 PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like isoform X1 [Prunus mume] XP_008219083.2 PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like isoform X1 [Prunus mume] XP_016646870.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like isoform X1 [Prunus mume] XP_016646871.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like isoform X1 [Prunus mume] XP_016646872.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like isoform X1 [Prunus mume] Length = 724 Score = 74.3 bits (181), Expect = 4e-13 Identities = 33/50 (66%), Positives = 43/50 (86%) Frame = +1 Query: 1 VVLDQELTSTILICLCNVSEDLDMAKLLPTFSQKMSEGKSISCNKLLLKL 150 V+LD E+TSTIL CLC +S+D D+ K+LPTFSQ+ S+G SISCN+LL+KL Sbjct: 666 VILDSEITSTILSCLCQISDDYDVMKILPTFSQETSKGASISCNELLMKL 715 >XP_009379032.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Pyrus x bretschneideri] Length = 733 Score = 73.6 bits (179), Expect = 8e-13 Identities = 33/50 (66%), Positives = 44/50 (88%) Frame = +1 Query: 1 VVLDQELTSTILICLCNVSEDLDMAKLLPTFSQKMSEGKSISCNKLLLKL 150 VVLD E+TSTIL CLC +S+D+D+ K+LPTFSQ+ S+G SI+CN+LL+KL Sbjct: 666 VVLDSEITSTILECLCEISDDVDVMKILPTFSQETSKGASITCNELLVKL 715 >XP_008378727.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Malus domestica] XP_008378729.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Malus domestica] Length = 733 Score = 73.6 bits (179), Expect = 8e-13 Identities = 33/50 (66%), Positives = 44/50 (88%) Frame = +1 Query: 1 VVLDQELTSTILICLCNVSEDLDMAKLLPTFSQKMSEGKSISCNKLLLKL 150 VVLD E+TSTIL CLC +S+D+D+ K+LPTFSQ+ S+G SI+CN+LL+KL Sbjct: 666 VVLDSEITSTILECLCEISDDVDVMKILPTFSQETSKGASITCNELLVKL 715 >XP_003623229.2 TCP-1/cpn60 chaperonin family protein [Medicago truncatula] AES79447.2 TCP-1/cpn60 chaperonin family protein [Medicago truncatula] Length = 713 Score = 72.0 bits (175), Expect = 3e-12 Identities = 34/53 (64%), Positives = 42/53 (79%) Frame = +1 Query: 1 VVLDQELTSTILICLCNVSEDLDMAKLLPTFSQKMSEGKSISCNKLLLKLRSV 159 VVLD +LTSTIL CLCN+S+D+D+ K+LP FSQ S G SI CN+LL+KL V Sbjct: 652 VVLDSKLTSTILACLCNMSKDVDIEKILPKFSQHTSVGASIKCNELLMKLNKV 704 >XP_015873656.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Ziziphus jujuba] Length = 727 Score = 71.2 bits (173), Expect = 5e-12 Identities = 34/57 (59%), Positives = 45/57 (78%) Frame = +1 Query: 1 VVLDQELTSTILICLCNVSEDLDMAKLLPTFSQKMSEGKSISCNKLLLKLRSVTRNL 171 VVLD E+T+TIL CLC++SEDLD+ K+LPTF+QK S G S S N+LL+KL + +L Sbjct: 666 VVLDSEITNTILACLCDLSEDLDVMKILPTFTQKTSRGTSTSFNELLMKLNELHPDL 722 >GAV62124.1 PPR domain-containing protein/PPR_1 domain-containing protein/PPR_2 domain-containing protein [Cephalotus follicularis] Length = 739 Score = 69.7 bits (169), Expect = 2e-11 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = +1 Query: 1 VVLDQELTSTILICLCNVSEDLDMAKLLPTFSQKMSEGKSISCNKLLLKLR 153 VVLD ELTSTIL C+C+ SE +M +LLPTFSQ+ S+G S SCN LL+KLR Sbjct: 683 VVLDSELTSTILTCVCHSSEGHNMVELLPTFSQEASKGTSFSCNDLLIKLR 733 >XP_015082055.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Solanum pennellii] XP_015082057.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Solanum pennellii] XP_015082058.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Solanum pennellii] Length = 737 Score = 68.6 bits (166), Expect = 5e-11 Identities = 33/51 (64%), Positives = 42/51 (82%) Frame = +1 Query: 1 VVLDQELTSTILICLCNVSEDLDMAKLLPTFSQKMSEGKSISCNKLLLKLR 153 + LD LTSTIL CLCN+SEDL++ +LLP FSQK SEG SI C++LL+KL+ Sbjct: 675 IELDLGLTSTILECLCNISEDLNVEELLPNFSQKKSEGFSIPCSELLMKLQ 725 >XP_006346263.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Solanum tuberosum] Length = 737 Score = 68.6 bits (166), Expect = 5e-11 Identities = 33/51 (64%), Positives = 42/51 (82%) Frame = +1 Query: 1 VVLDQELTSTILICLCNVSEDLDMAKLLPTFSQKMSEGKSISCNKLLLKLR 153 + LD LTSTIL CLCN+SEDL++ +LLP FSQK SEG SI C++LL+KL+ Sbjct: 675 IELDLGLTSTILQCLCNISEDLNVEELLPNFSQKKSEGFSIPCSELLMKLQ 725 >XP_004244115.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Solanum lycopersicum] XP_010324314.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Solanum lycopersicum] XP_010324315.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Solanum lycopersicum] Length = 737 Score = 68.6 bits (166), Expect = 5e-11 Identities = 33/51 (64%), Positives = 42/51 (82%) Frame = +1 Query: 1 VVLDQELTSTILICLCNVSEDLDMAKLLPTFSQKMSEGKSISCNKLLLKLR 153 + LD LTSTIL CLCN+SEDL++ +LLP FSQK SEG SI C++LL+KL+ Sbjct: 675 IELDLGLTSTILECLCNISEDLNVEELLPNFSQKKSEGFSIPCSELLMKLQ 725 >GAU35669.1 hypothetical protein TSUD_162400 [Trifolium subterraneum] Length = 724 Score = 67.8 bits (164), Expect = 9e-11 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = +1 Query: 1 VVLDQELTSTILICLCNVSEDLDMAKLLPTFSQKMSEGKSISCNKLLLKLRSV 159 VVLD +LTSTIL CLCN+ + LD+ K+LP FSQ S G +I CN+LL+KL V Sbjct: 663 VVLDSKLTSTILACLCNMPKGLDIKKILPNFSQHASVGANIKCNELLMKLNKV 715 >XP_004492420.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like isoform X1 [Cicer arietinum] XP_012569019.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like isoform X1 [Cicer arietinum] XP_012569020.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like isoform X1 [Cicer arietinum] XP_012569021.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like isoform X1 [Cicer arietinum] Length = 721 Score = 67.0 bits (162), Expect = 2e-10 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = +1 Query: 1 VVLDQELTSTILICLCNVSEDLDMAKLLPTFSQKMSEGKSISCNKLLLKLRSV 159 VVLD +LTS IL C+C VS+D+D+ K+LP FSQ S G +I CN+LL+KL V Sbjct: 660 VVLDSKLTSIILACICKVSKDIDIDKILPKFSQHTSVGSNIKCNELLMKLNKV 712 >XP_016464226.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Nicotiana tabacum] XP_016464234.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Nicotiana tabacum] XP_016464241.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Nicotiana tabacum] XP_016464246.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Nicotiana tabacum] XP_016464251.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Nicotiana tabacum] Length = 733 Score = 67.0 bits (162), Expect = 2e-10 Identities = 31/50 (62%), Positives = 41/50 (82%) Frame = +1 Query: 1 VVLDQELTSTILICLCNVSEDLDMAKLLPTFSQKMSEGKSISCNKLLLKL 150 + LD +TSTIL CLCN SED+++ +LLP FSQK+SEG SI C++LL+KL Sbjct: 671 IELDSRITSTILECLCNFSEDINVEELLPKFSQKISEGFSIPCSELLMKL 720 >EYU46193.1 hypothetical protein MIMGU_mgv1a026384mg [Erythranthe guttata] Length = 641 Score = 66.6 bits (161), Expect = 2e-10 Identities = 31/57 (54%), Positives = 42/57 (73%) Frame = +1 Query: 1 VVLDQELTSTILICLCNVSEDLDMAKLLPTFSQKMSEGKSISCNKLLLKLRSVTRNL 171 VVLD E+TSTIL CLC+VSE D+ KL+P F+Q+ EG SI C++LL +L ++ L Sbjct: 576 VVLDSEITSTILTCLCDVSEGCDVVKLIPKFTQEKLEGSSIPCDELLRRLENIVPTL 632 >XP_012853570.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Erythranthe guttata] XP_012853630.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Erythranthe guttata] XP_012853693.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Erythranthe guttata] XP_012853760.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Erythranthe guttata] XP_012853815.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Erythranthe guttata] XP_012853859.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Erythranthe guttata] XP_012853912.1 PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Erythranthe guttata] Length = 745 Score = 66.6 bits (161), Expect = 2e-10 Identities = 31/57 (54%), Positives = 42/57 (73%) Frame = +1 Query: 1 VVLDQELTSTILICLCNVSEDLDMAKLLPTFSQKMSEGKSISCNKLLLKLRSVTRNL 171 VVLD E+TSTIL CLC+VSE D+ KL+P F+Q+ EG SI C++LL +L ++ L Sbjct: 680 VVLDSEITSTILTCLCDVSEGCDVVKLIPKFTQEKLEGSSIPCDELLRRLENIVPTL 736