BLASTX nr result
ID: Phellodendron21_contig00035439
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00035439 (370 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007406482.1 hypothetical protein MELLADRAFT_71078 [Melampsora... 82 4e-17 XP_003325877.1 hypothetical protein PGTG_07079 [Puccinia gramini... 55 2e-06 OAV92385.1 hypothetical protein PTTG_02221 [Puccinia triticina 1... 54 3e-06 >XP_007406482.1 hypothetical protein MELLADRAFT_71078 [Melampsora larici-populina 98AG31] EGG10181.1 hypothetical protein MELLADRAFT_71078 [Melampsora larici-populina 98AG31] Length = 165 Score = 81.6 bits (200), Expect = 4e-17 Identities = 37/59 (62%), Positives = 45/59 (76%) Frame = -1 Query: 370 PRNSSRDSAAVANWVMSPLERAEIEACSWAAESGSAGIPLRGEVVKEVWRHLRNVTRMP 194 P N+S+DS+AV NWVMSPL+RAEIEACSW +E P G VVKEVW ++RN+ RMP Sbjct: 107 PDNTSKDSSAVGNWVMSPLKRAEIEACSWVSEDSQNASPHYGTVVKEVWDNVRNLMRMP 165 >XP_003325877.1 hypothetical protein PGTG_07079 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP81458.1 hypothetical protein PGTG_07079 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 252 Score = 54.7 bits (130), Expect = 2e-06 Identities = 26/56 (46%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = -1 Query: 364 NSSRDSAAVANWVMSPLERAEIEACSWAAESGSAGIPL-RGEVVKEVWRHLRNVTR 200 N S+D V WV+SPL R EIEACSW E + P RG VV E W+ + + R Sbjct: 196 NPSKDPGDVGRWVLSPLTRPEIEACSWDVEDSPSSNPQHRGSVVLEAWKQILEIIR 251 >OAV92385.1 hypothetical protein PTTG_02221 [Puccinia triticina 1-1 BBBD Race 1] Length = 253 Score = 54.3 bits (129), Expect = 3e-06 Identities = 26/56 (46%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = -1 Query: 364 NSSRDSAAVANWVMSPLERAEIEACSWAAESGSAGIPL-RGEVVKEVWRHLRNVTR 200 N S+D V WV+SPL R EIEACSW E + PL + VV EVW+ + + R Sbjct: 197 NPSKDPRDVGRWVLSPLNRPEIEACSWDVEHSPSANPLHQASVVLEVWQQISEILR 252