BLASTX nr result
ID: Phellodendron21_contig00035424
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00035424 (351 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KNE94676.1 hypothetical protein, variant [Puccinia striiformis f... 79 9e-15 KNE94675.1 hypothetical protein PSTG_11949 [Puccinia striiformis... 79 9e-15 KNZ51225.1 hypothetical protein VP01_403g4 [Puccinia sorghi] 78 2e-14 KDE06267.1 hypothetical protein MVLG_03426 [Microbotryum lychnid... 59 1e-07 >KNE94676.1 hypothetical protein, variant [Puccinia striiformis f. sp. tritici PST-78] Length = 1336 Score = 79.0 bits (193), Expect = 9e-15 Identities = 35/48 (72%), Positives = 38/48 (79%) Frame = -3 Query: 196 PARPKPIRRAHKICCMFIPSTWIEQLSTGEEVAKGVGDIEKARWALVC 53 P+RPKPI+ AH+ICCMF PSTW E L TGEEV KG IEKARWAL C Sbjct: 987 PSRPKPIKWAHRICCMFTPSTWFEILPTGEEVVKGFEAIEKARWALKC 1034 >KNE94675.1 hypothetical protein PSTG_11949 [Puccinia striiformis f. sp. tritici PST-78] Length = 1349 Score = 79.0 bits (193), Expect = 9e-15 Identities = 35/48 (72%), Positives = 38/48 (79%) Frame = -3 Query: 196 PARPKPIRRAHKICCMFIPSTWIEQLSTGEEVAKGVGDIEKARWALVC 53 P+RPKPI+ AH+ICCMF PSTW E L TGEEV KG IEKARWAL C Sbjct: 1000 PSRPKPIKWAHRICCMFTPSTWFEILPTGEEVVKGFEAIEKARWALKC 1047 >KNZ51225.1 hypothetical protein VP01_403g4 [Puccinia sorghi] Length = 1577 Score = 77.8 bits (190), Expect = 2e-14 Identities = 34/48 (70%), Positives = 36/48 (75%) Frame = -3 Query: 196 PARPKPIRRAHKICCMFIPSTWIEQLSTGEEVAKGVGDIEKARWALVC 53 P RPKPI+ AHK+CCMF PSTW E L GEEV KG IEKARWAL C Sbjct: 1206 PPRPKPIKWAHKVCCMFTPSTWFETLPNGEEVVKGFEAIEKARWALKC 1253 >KDE06267.1 hypothetical protein MVLG_03426 [Microbotryum lychnidis-dioicae p1A1 Lamole] Length = 1440 Score = 58.5 bits (140), Expect = 1e-07 Identities = 31/61 (50%), Positives = 39/61 (63%), Gaps = 1/61 (1%) Frame = -3 Query: 232 QTSGSALVKPNAPARPKPIRRAHKICCMFIPSTWIEQL-STGEEVAKGVGDIEKARWALV 56 + S LVK PA+ K + AH++C MF P+TWIE + GEEV +G DIEKARW L Sbjct: 934 ERSTEGLVKIGEPAQFKML--AHRVCVMFTPATWIETVPEMGEEVVRGFLDIEKARWKLK 991 Query: 55 C 53 C Sbjct: 992 C 992