BLASTX nr result
ID: Phellodendron21_contig00035393
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00035393 (402 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO48918.1 hypothetical protein CISIN_1g0122871mg, partial [Citr... 56 5e-07 XP_006471677.1 PREDICTED: light-inducible protein CPRF2 [Citrus ... 56 1e-06 XP_006432930.1 hypothetical protein CICLE_v10001051mg [Citrus cl... 56 1e-06 >KDO48918.1 hypothetical protein CISIN_1g0122871mg, partial [Citrus sinensis] KDO48919.1 hypothetical protein CISIN_1g0122871mg, partial [Citrus sinensis] Length = 195 Score = 56.2 bits (134), Expect = 5e-07 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -3 Query: 328 AVTNAVSFNGSQISEDYQAFLKSKLNVACAAVALSRVS 215 A T+A+SF+G+Q EDYQA LKSKLN+ACAAVALSR S Sbjct: 129 AATSALSFDGTQNLEDYQAVLKSKLNLACAAVALSRAS 166 >XP_006471677.1 PREDICTED: light-inducible protein CPRF2 [Citrus sinensis] Length = 432 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -3 Query: 328 AVTNAVSFNGSQISEDYQAFLKSKLNVACAAVALSRVS 215 A T+A+SF+G+Q EDYQA LKSKLN+ACAAVALSR S Sbjct: 95 AATSALSFDGTQNLEDYQAVLKSKLNLACAAVALSRAS 132 >XP_006432930.1 hypothetical protein CICLE_v10001051mg [Citrus clementina] ESR46170.1 hypothetical protein CICLE_v10001051mg [Citrus clementina] Length = 468 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -3 Query: 328 AVTNAVSFNGSQISEDYQAFLKSKLNVACAAVALSRVS 215 A T+A+SF+G+Q EDYQA LKSKLN+ACAAVALSR S Sbjct: 131 AATSALSFDGTQNLEDYQAVLKSKLNLACAAVALSRAS 168