BLASTX nr result
ID: Phellodendron21_contig00035326
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00035326 (259 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO76722.1 hypothetical protein CISIN_1g009414mg [Citrus sinensis] 101 3e-23 XP_006476290.1 PREDICTED: cytochrome P450 78A9-like [Citrus sine... 101 3e-23 XP_006439222.1 hypothetical protein CICLE_v10019657mg [Citrus cl... 101 3e-23 XP_018814196.1 PREDICTED: cytochrome P450 78A3-like [Juglans regia] 93 2e-20 XP_016737006.1 PREDICTED: cytochrome P450 78A9-like [Gossypium h... 91 1e-19 XP_012470415.1 PREDICTED: cytochrome P450 78A9-like [Gossypium r... 91 1e-19 XP_016737215.1 PREDICTED: cytochrome P450 78A3-like [Gossypium h... 91 2e-19 XP_012439839.1 PREDICTED: cytochrome P450 78A3-like [Gossypium r... 91 2e-19 XP_017635240.1 PREDICTED: cytochrome P450 78A3-like [Gossypium a... 90 3e-19 XP_016741565.1 PREDICTED: cytochrome P450 78A9-like [Gossypium h... 90 3e-19 XP_017627859.1 PREDICTED: cytochrome P450 78A9-like [Gossypium a... 90 3e-19 XP_002518911.1 PREDICTED: cytochrome P450 78A9 [Ricinus communis... 89 8e-19 XP_016738112.1 PREDICTED: cytochrome P450 78A3-like [Gossypium h... 88 1e-18 XP_016694981.1 PREDICTED: cytochrome P450 78A3-like [Gossypium h... 88 1e-18 XP_017625464.1 PREDICTED: cytochrome P450 78A3-like [Gossypium a... 87 5e-18 XP_012474775.1 PREDICTED: cytochrome P450 78A3-like [Gossypium r... 87 5e-18 XP_002304580.1 hypothetical protein POPTR_0003s14670g [Populus t... 86 7e-18 XP_011022416.1 PREDICTED: cytochrome P450 78A9-like [Populus eup... 86 9e-18 XP_018824322.1 PREDICTED: cytochrome P450 78A9-like [Juglans regia] 85 2e-17 XP_011026787.1 PREDICTED: cytochrome P450 78A9-like [Populus eup... 84 3e-17 >KDO76722.1 hypothetical protein CISIN_1g009414mg [Citrus sinensis] Length = 535 Score = 101 bits (251), Expect = 3e-23 Identities = 45/61 (73%), Positives = 52/61 (85%), Gaps = 2/61 (3%) Frame = +3 Query: 81 METKIDCFWVLAIASKYKSFTSQNTILVSIFLCMA--WLAMAFCYWAYPGGHAWGKYLFK 254 ME+KIDCFWVLA+ASK KS T QN IL SI LCMA WLAMA C+WA+PGGHAWGK+L+K Sbjct: 1 MESKIDCFWVLALASKCKSLTFQNNILASILLCMAFFWLAMALCFWAHPGGHAWGKHLYK 60 Query: 255 R 257 + Sbjct: 61 K 61 >XP_006476290.1 PREDICTED: cytochrome P450 78A9-like [Citrus sinensis] Length = 535 Score = 101 bits (251), Expect = 3e-23 Identities = 45/61 (73%), Positives = 52/61 (85%), Gaps = 2/61 (3%) Frame = +3 Query: 81 METKIDCFWVLAIASKYKSFTSQNTILVSIFLCMA--WLAMAFCYWAYPGGHAWGKYLFK 254 ME+KIDCFWVLA+ASK KS T QN IL SI LCMA WLAMA C+WA+PGGHAWGK+L+K Sbjct: 1 MESKIDCFWVLALASKCKSLTFQNNILASILLCMALFWLAMALCFWAHPGGHAWGKHLYK 60 Query: 255 R 257 + Sbjct: 61 K 61 >XP_006439222.1 hypothetical protein CICLE_v10019657mg [Citrus clementina] ESR52462.1 hypothetical protein CICLE_v10019657mg [Citrus clementina] Length = 535 Score = 101 bits (251), Expect = 3e-23 Identities = 45/61 (73%), Positives = 52/61 (85%), Gaps = 2/61 (3%) Frame = +3 Query: 81 METKIDCFWVLAIASKYKSFTSQNTILVSIFLCMA--WLAMAFCYWAYPGGHAWGKYLFK 254 ME+KIDCFWVLA+ASK KS T QN IL SI LCMA WLAMA C+WA+PGGHAWGK+L+K Sbjct: 1 MESKIDCFWVLALASKCKSLTFQNNILASILLCMAFFWLAMALCFWAHPGGHAWGKHLYK 60 Query: 255 R 257 + Sbjct: 61 K 61 >XP_018814196.1 PREDICTED: cytochrome P450 78A3-like [Juglans regia] Length = 530 Score = 93.2 bits (230), Expect = 2e-20 Identities = 37/58 (63%), Positives = 49/58 (84%) Frame = +3 Query: 81 METKIDCFWVLAIASKYKSFTSQNTILVSIFLCMAWLAMAFCYWAYPGGHAWGKYLFK 254 M+T++D WVLA+ASK K+F+S NT+ + +F+CMAWLA+A CYWAYPGG AWGKY +K Sbjct: 1 MKTQVDTLWVLALASKCKAFSSPNTLFLFVFICMAWLALALCYWAYPGGPAWGKYWWK 58 >XP_016737006.1 PREDICTED: cytochrome P450 78A9-like [Gossypium hirsutum] Length = 530 Score = 91.3 bits (225), Expect = 1e-19 Identities = 40/59 (67%), Positives = 47/59 (79%) Frame = +3 Query: 81 METKIDCFWVLAIASKYKSFTSQNTILVSIFLCMAWLAMAFCYWAYPGGHAWGKYLFKR 257 METK DCFWVL +ASK K+F+S NTIL+ + LCMAWLAMA +W YPGG AWGKY +R Sbjct: 1 METKTDCFWVLFLASKCKTFSSSNTILLLLSLCMAWLAMALWFWFYPGGPAWGKYYRRR 59 >XP_012470415.1 PREDICTED: cytochrome P450 78A9-like [Gossypium raimondii] KJB18954.1 hypothetical protein B456_003G077000 [Gossypium raimondii] Length = 530 Score = 91.3 bits (225), Expect = 1e-19 Identities = 40/59 (67%), Positives = 47/59 (79%) Frame = +3 Query: 81 METKIDCFWVLAIASKYKSFTSQNTILVSIFLCMAWLAMAFCYWAYPGGHAWGKYLFKR 257 METK DCFWVL +ASK K+F+S NTIL+ + LCMAWLAMA +W YPGG AWGKY +R Sbjct: 1 METKTDCFWVLFLASKCKTFSSSNTILLLLSLCMAWLAMALWFWFYPGGPAWGKYYRRR 59 >XP_016737215.1 PREDICTED: cytochrome P450 78A3-like [Gossypium hirsutum] Length = 530 Score = 90.5 bits (223), Expect = 2e-19 Identities = 37/55 (67%), Positives = 45/55 (81%) Frame = +3 Query: 81 METKIDCFWVLAIASKYKSFTSQNTILVSIFLCMAWLAMAFCYWAYPGGHAWGKY 245 MET DCFWVL +ASK KSF++QN+IL+ +FLCMAW A+ C+W YPGG AWGKY Sbjct: 1 METHSDCFWVLFLASKCKSFSTQNSILLLLFLCMAWFAITLCFWFYPGGPAWGKY 55 >XP_012439839.1 PREDICTED: cytochrome P450 78A3-like [Gossypium raimondii] KJB52370.1 hypothetical protein B456_008G258700 [Gossypium raimondii] Length = 530 Score = 90.5 bits (223), Expect = 2e-19 Identities = 37/55 (67%), Positives = 45/55 (81%) Frame = +3 Query: 81 METKIDCFWVLAIASKYKSFTSQNTILVSIFLCMAWLAMAFCYWAYPGGHAWGKY 245 MET DCFWVL +ASK KSF++QN+IL+ +FLCMAW A+ C+W YPGG AWGKY Sbjct: 1 METHSDCFWVLFLASKCKSFSTQNSILLLLFLCMAWFAITLCFWFYPGGPAWGKY 55 >XP_017635240.1 PREDICTED: cytochrome P450 78A3-like [Gossypium arboreum] Length = 530 Score = 90.1 bits (222), Expect = 3e-19 Identities = 37/55 (67%), Positives = 44/55 (80%) Frame = +3 Query: 81 METKIDCFWVLAIASKYKSFTSQNTILVSIFLCMAWLAMAFCYWAYPGGHAWGKY 245 MET DCFW L +ASK KSF++QN+IL+ +FLCMAW AM C+W YPGG AWGKY Sbjct: 1 METHSDCFWFLFLASKCKSFSTQNSILLLLFLCMAWFAMTLCFWFYPGGPAWGKY 55 >XP_016741565.1 PREDICTED: cytochrome P450 78A9-like [Gossypium hirsutum] Length = 530 Score = 90.1 bits (222), Expect = 3e-19 Identities = 39/55 (70%), Positives = 45/55 (81%) Frame = +3 Query: 81 METKIDCFWVLAIASKYKSFTSQNTILVSIFLCMAWLAMAFCYWAYPGGHAWGKY 245 METK DCFWVL +ASK K+F+S NTIL+ + LCMAWLAMA +W YPGG AWGKY Sbjct: 1 METKTDCFWVLFLASKCKTFSSSNTILLLLSLCMAWLAMALWFWFYPGGPAWGKY 55 >XP_017627859.1 PREDICTED: cytochrome P450 78A9-like [Gossypium arboreum] KHG00006.1 Cytochrome P450 [Gossypium arboreum] Length = 530 Score = 90.1 bits (222), Expect = 3e-19 Identities = 39/55 (70%), Positives = 45/55 (81%) Frame = +3 Query: 81 METKIDCFWVLAIASKYKSFTSQNTILVSIFLCMAWLAMAFCYWAYPGGHAWGKY 245 METK DCFWVL +ASK K+F+S NTIL+ + LCMAWLAMA +W YPGG AWGKY Sbjct: 1 METKTDCFWVLFLASKCKTFSSSNTILLLLSLCMAWLAMALWFWFYPGGPAWGKY 55 >XP_002518911.1 PREDICTED: cytochrome P450 78A9 [Ricinus communis] EEF43444.1 cytochrome P450, putative [Ricinus communis] Length = 531 Score = 89.0 bits (219), Expect = 8e-19 Identities = 38/59 (64%), Positives = 46/59 (77%) Frame = +3 Query: 81 METKIDCFWVLAIASKYKSFTSQNTILVSIFLCMAWLAMAFCYWAYPGGHAWGKYLFKR 257 M T+ID WV+A+ SK ++ +SQNT + FLCMA LAMA CYWA+PGGHAWGKY FKR Sbjct: 1 MGTQIDSLWVIALFSKCRAISSQNTAFLLFFLCMASLAMALCYWAHPGGHAWGKYFFKR 59 >XP_016738112.1 PREDICTED: cytochrome P450 78A3-like [Gossypium hirsutum] Length = 532 Score = 88.2 bits (217), Expect = 1e-18 Identities = 35/59 (59%), Positives = 45/59 (76%) Frame = +3 Query: 81 METKIDCFWVLAIASKYKSFTSQNTILVSIFLCMAWLAMAFCYWAYPGGHAWGKYLFKR 257 MET DCFW+L IASK+K+F+SQN++ + + LCM WL M C+W YPGG AWGKY + R Sbjct: 1 METNSDCFWLLFIASKFKTFSSQNSVWLLLLLCMGWLGMTLCFWLYPGGPAWGKYHWLR 59 >XP_016694981.1 PREDICTED: cytochrome P450 78A3-like [Gossypium hirsutum] Length = 555 Score = 88.2 bits (217), Expect = 1e-18 Identities = 37/60 (61%), Positives = 45/60 (75%) Frame = +3 Query: 78 SMETKIDCFWVLAIASKYKSFTSQNTILVSIFLCMAWLAMAFCYWAYPGGHAWGKYLFKR 257 SMET DCFW+L IASK K+F+SQN+I + + LCM WL M C+W YPGG AWGKY + R Sbjct: 22 SMETNSDCFWLLFIASKCKTFSSQNSIWLLLLLCMGWLGMTLCFWLYPGGPAWGKYHWLR 81 >XP_017625464.1 PREDICTED: cytochrome P450 78A3-like [Gossypium arboreum] Length = 532 Score = 86.7 bits (213), Expect = 5e-18 Identities = 35/59 (59%), Positives = 44/59 (74%) Frame = +3 Query: 81 METKIDCFWVLAIASKYKSFTSQNTILVSIFLCMAWLAMAFCYWAYPGGHAWGKYLFKR 257 MET DCFW+L IASK K+F+SQN++ + + LCM WL M C+W YPGG AWGKY + R Sbjct: 1 METNSDCFWLLFIASKCKTFSSQNSVWLLLLLCMGWLGMTLCFWLYPGGPAWGKYRWLR 59 >XP_012474775.1 PREDICTED: cytochrome P450 78A3-like [Gossypium raimondii] KJB24139.1 hypothetical protein B456_004G129700 [Gossypium raimondii] Length = 533 Score = 86.7 bits (213), Expect = 5e-18 Identities = 36/59 (61%), Positives = 44/59 (74%) Frame = +3 Query: 81 METKIDCFWVLAIASKYKSFTSQNTILVSIFLCMAWLAMAFCYWAYPGGHAWGKYLFKR 257 MET DCFW+L IASK K+F+SQN+I + + LCM WL M C+W YPGG AWGKY + R Sbjct: 1 METNSDCFWLLFIASKCKTFSSQNSIWLLLLLCMGWLGMTLCFWLYPGGPAWGKYHWLR 59 >XP_002304580.1 hypothetical protein POPTR_0003s14670g [Populus trichocarpa] ABK92929.1 unknown [Populus trichocarpa] EEE79559.1 hypothetical protein POPTR_0003s14670g [Populus trichocarpa] Length = 531 Score = 86.3 bits (212), Expect = 7e-18 Identities = 37/59 (62%), Positives = 46/59 (77%) Frame = +3 Query: 81 METKIDCFWVLAIASKYKSFTSQNTILVSIFLCMAWLAMAFCYWAYPGGHAWGKYLFKR 257 MET+ID FWVLA+ SK K+F+SQ+ I + + L +AWLA+A CYW YPGG AWGKY KR Sbjct: 1 METQIDSFWVLALVSKCKAFSSQDPIFLLLSLFLAWLAIALCYWVYPGGPAWGKYWLKR 59 >XP_011022416.1 PREDICTED: cytochrome P450 78A9-like [Populus euphratica] Length = 531 Score = 85.9 bits (211), Expect = 9e-18 Identities = 36/59 (61%), Positives = 46/59 (77%) Frame = +3 Query: 81 METKIDCFWVLAIASKYKSFTSQNTILVSIFLCMAWLAMAFCYWAYPGGHAWGKYLFKR 257 MET+ID FWVLA+ SK K+F+ Q+ I + ++L +AWLA+A CYW YPGG AWGKY KR Sbjct: 1 METQIDSFWVLALVSKCKAFSFQDPIFLLLYLFLAWLAIALCYWVYPGGPAWGKYWLKR 59 >XP_018824322.1 PREDICTED: cytochrome P450 78A9-like [Juglans regia] Length = 527 Score = 85.1 bits (209), Expect = 2e-17 Identities = 35/58 (60%), Positives = 45/58 (77%) Frame = +3 Query: 81 METKIDCFWVLAIASKYKSFTSQNTILVSIFLCMAWLAMAFCYWAYPGGHAWGKYLFK 254 MET++D WVL +A K K F+SQNTI + +FLC AWL++A YWAYPGG AWG+Y +K Sbjct: 1 METQVDTLWVLVLACKCKGFSSQNTIFLFVFLCGAWLSLALWYWAYPGGPAWGRYWWK 58 >XP_011026787.1 PREDICTED: cytochrome P450 78A9-like [Populus euphratica] Length = 532 Score = 84.3 bits (207), Expect = 3e-17 Identities = 34/59 (57%), Positives = 45/59 (76%) Frame = +3 Query: 81 METKIDCFWVLAIASKYKSFTSQNTILVSIFLCMAWLAMAFCYWAYPGGHAWGKYLFKR 257 MET+ID FWVL + SK K+F++QN I + + + +AWLA+A CYW YPGG AWG YL K+ Sbjct: 1 METQIDSFWVLVLVSKCKAFSAQNPIFLLVSVFLAWLALALCYWVYPGGPAWGNYLIKK 59