BLASTX nr result
ID: Phellodendron21_contig00035312
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00035312 (271 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007418572.1 hypothetical protein MELLADRAFT_118591 [Melampsor... 62 4e-09 >XP_007418572.1 hypothetical protein MELLADRAFT_118591 [Melampsora larici-populina 98AG31] EGF98155.1 hypothetical protein MELLADRAFT_118591 [Melampsora larici-populina 98AG31] Length = 686 Score = 61.6 bits (148), Expect = 4e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 239 LGMGEVVMTPTTEEWRSLGGLPGDMRKFRDDL 144 L +GEVVMTPTTEEWRSLGGLPGDMRKF D L Sbjct: 141 LRLGEVVMTPTTEEWRSLGGLPGDMRKFTDGL 172