BLASTX nr result
ID: Phellodendron21_contig00035310
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00035310 (336 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007417697.1 hypothetical protein MELLADRAFT_94936 [Melampsora... 59 1e-07 OAV99555.1 hypothetical protein PTTG_09486 [Puccinia triticina 1... 55 2e-06 KNF04100.1 hypothetical protein PSTG_02806 [Puccinia striiformis... 55 2e-06 KNZ53423.1 hypothetical protein VP01_3240g1 [Puccinia sorghi] 55 2e-06 >XP_007417697.1 hypothetical protein MELLADRAFT_94936 [Melampsora larici-populina 98AG31] EGF99056.1 hypothetical protein MELLADRAFT_94936 [Melampsora larici-populina 98AG31] Length = 772 Score = 58.5 bits (140), Expect = 1e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +3 Query: 3 KEFVAGITELLKNNGAFVDTLYARYLARYAEKFL 104 KEFV G+ EL+K NGAFVD LYARYLARYAE++L Sbjct: 739 KEFVGGVLELIKTNGAFVDMLYARYLARYAERYL 772 >OAV99555.1 hypothetical protein PTTG_09486 [Puccinia triticina 1-1 BBBD Race 1] Length = 753 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 9 FVAGITELLKNNGAFVDTLYARYLARYAEKFL 104 FV I +L+ NNGAFVDTLYARYLARYAEK+L Sbjct: 722 FVNSILDLINNNGAFVDTLYARYLARYAEKYL 753 >KNF04100.1 hypothetical protein PSTG_02806 [Puccinia striiformis f. sp. tritici PST-78] Length = 782 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 9 FVAGITELLKNNGAFVDTLYARYLARYAEKFL 104 FV I +L+ NNGAFVDTLYARYLARYAEK+L Sbjct: 751 FVNSILDLINNNGAFVDTLYARYLARYAEKYL 782 >KNZ53423.1 hypothetical protein VP01_3240g1 [Puccinia sorghi] Length = 786 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 9 FVAGITELLKNNGAFVDTLYARYLARYAEKFL 104 FV I +L+ NNGAFVDTLYARYLARYAEK+L Sbjct: 755 FVHSILDLINNNGAFVDTLYARYLARYAEKYL 786