BLASTX nr result
ID: Phellodendron21_contig00035287
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00035287 (252 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAV89510.1 hypothetical protein PTTG_04135 [Puccinia triticina 1... 59 2e-08 XP_003325966.2 hypothetical protein PGTG_07796 [Puccinia gramini... 58 7e-08 KNE89398.1 hypothetical protein PSTG_17142 [Puccinia striiformis... 56 2e-07 KNZ50498.1 hypothetical protein VP01_438g1 [Puccinia sorghi] 52 6e-06 >OAV89510.1 hypothetical protein PTTG_04135 [Puccinia triticina 1-1 BBBD Race 1] Length = 923 Score = 59.3 bits (142), Expect = 2e-08 Identities = 29/68 (42%), Positives = 47/68 (69%), Gaps = 1/68 (1%) Frame = +2 Query: 44 PQETSRLQPIQSVSGAQKRDVDQVTHEIISKLKRGKYNENV-QSIDRLARFLSPDTNISL 220 P+++ QP +V G KRD D+ +++IS+ KR K+ E+ ++I RLA+FL PD N++L Sbjct: 359 PRQSFSAQPPPAVGG-HKRDYDEAVYDLISRCKRSKFEEDSDETIARLAKFLCPDVNLNL 417 Query: 221 PDLERHNS 244 P L+ H+S Sbjct: 418 PSLDSHSS 425 >XP_003325966.2 hypothetical protein PGTG_07796 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP81547.2 hypothetical protein PGTG_07796 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 984 Score = 57.8 bits (138), Expect = 7e-08 Identities = 29/68 (42%), Positives = 45/68 (66%), Gaps = 1/68 (1%) Frame = +2 Query: 44 PQETSRLQPIQSVSGAQKRDVDQVTHEIISKLKRGKYNENV-QSIDRLARFLSPDTNISL 220 P+ + QP V G KRD D+ +++IS+ KR K+ E+ ++I RLA+FL PD N++L Sbjct: 370 PRHSFSAQPPPPVGG-HKRDYDEAVYDLISRCKRSKFEEDSDETIARLAKFLCPDVNLNL 428 Query: 221 PDLERHNS 244 P L+ H+S Sbjct: 429 PSLDSHSS 436 >KNE89398.1 hypothetical protein PSTG_17142 [Puccinia striiformis f. sp. tritici PST-78] KNE89399.1 hypothetical protein, variant 1 [Puccinia striiformis f. sp. tritici PST-78] KNE89400.1 hypothetical protein, variant 2 [Puccinia striiformis f. sp. tritici PST-78] Length = 924 Score = 56.2 bits (134), Expect = 2e-07 Identities = 29/68 (42%), Positives = 45/68 (66%), Gaps = 1/68 (1%) Frame = +2 Query: 44 PQETSRLQPIQSVSGAQKRDVDQVTHEIISKLKRGKYNENV-QSIDRLARFLSPDTNISL 220 P+ + +QP +V G KRD D+ +++IS+ KR KY ++ ++I RLA+FLSPD N++ Sbjct: 368 PRHSFSVQPPPAVGG-HKRDYDEAVYDLISRCKRSKYEQDSDETIARLAKFLSPDVNLNP 426 Query: 221 PDLERHNS 244 P L H S Sbjct: 427 PSLASHCS 434 >KNZ50498.1 hypothetical protein VP01_438g1 [Puccinia sorghi] Length = 970 Score = 52.4 bits (124), Expect = 6e-06 Identities = 28/77 (36%), Positives = 39/77 (50%), Gaps = 24/77 (31%) Frame = +2 Query: 86 GAQKRDVDQVTHEIISKLKRGKYNEN------------------------VQSIDRLARF 193 G QKRD D+ +E+IS+ KR KY E+ + +I RL +F Sbjct: 383 GGQKRDYDEAVYELISRCKRSKYEEDSEGSESNDLVLVVPCMSSLTCFFFILAIARLTKF 442 Query: 194 LSPDTNISLPDLERHNS 244 LSPD N++LP L+ H S Sbjct: 443 LSPDVNLNLPSLDSHTS 459