BLASTX nr result
ID: Phellodendron21_contig00035248
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00035248 (383 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016765744.1 hypothetical protein SEPMUDRAFT_146595 [Sphaeruli... 64 2e-10 >XP_016765744.1 hypothetical protein SEPMUDRAFT_146595 [Sphaerulina musiva SO2202] EMF17623.1 hypothetical protein SEPMUDRAFT_146595 [Sphaerulina musiva SO2202] Length = 147 Score = 64.3 bits (155), Expect = 2e-10 Identities = 31/41 (75%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = -2 Query: 121 SATIPSYGN-ATLYGTGAHPSSTGIIPSPGAASGLQVCSMA 2 S TIP+YGN T++ TGA+PS+TGIIPSPGAASGLQ CSMA Sbjct: 94 SVTIPTYGNQTTVHPTGAYPSATGIIPSPGAASGLQACSMA 134