BLASTX nr result
ID: Phellodendron21_contig00035207
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00035207 (492 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007417887.1 hypothetical protein MELLADRAFT_118428 [Melampsor... 71 3e-12 XP_007411333.1 hypothetical protein MELLADRAFT_107697 [Melampsor... 71 2e-11 >XP_007417887.1 hypothetical protein MELLADRAFT_118428 [Melampsora larici-populina 98AG31] EGF98846.1 hypothetical protein MELLADRAFT_118428, partial [Melampsora larici-populina 98AG31] Length = 207 Score = 71.2 bits (173), Expect = 3e-12 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = +3 Query: 360 MTTTRFPNSSYKPPTRLTIEPYSAADQDAFAYQSTTRRGPMILT 491 MTTTRFPNSSY+PP R +IEPYSA++ + FAYQST +R PMILT Sbjct: 1 MTTTRFPNSSYQPPVRFSIEPYSASNPNTFAYQSTIKRWPMILT 44 >XP_007411333.1 hypothetical protein MELLADRAFT_107697 [Melampsora larici-populina 98AG31] EGG05411.1 hypothetical protein MELLADRAFT_107697 [Melampsora larici-populina 98AG31] Length = 463 Score = 71.2 bits (173), Expect = 2e-11 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = +3 Query: 360 MTTTRFPNSSYKPPTRLTIEPYSAADQDAFAYQSTTRRGPMILT 491 MTTTRFPNSSY+PP R +IEPYSA++ + FAYQST +R PMILT Sbjct: 1 MTTTRFPNSSYQPPVRFSIEPYSASNPNTFAYQSTIKRWPMILT 44