BLASTX nr result
ID: Phellodendron21_contig00035152
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00035152 (344 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KJY01845.1 rnp domain protein [Zymoseptoria brevis] 127 4e-33 XP_003853884.1 hypothetical protein MYCGRDRAFT_103773 [Zymosepto... 127 4e-33 XP_016758640.1 RNP domain protein [Sphaerulina musiva SO2202] EM... 124 5e-32 KEQ89618.1 RNA-binding domain-containing protein [Aureobasidium ... 121 7e-31 KXT17638.1 hypothetical protein AC579_10153 [Pseudocercospora mu... 121 8e-31 KXT03719.1 hypothetical protein AC578_5142 [Mycosphaerella eumusae] 121 8e-31 XP_007925052.1 hypothetical protein MYCFIDRAFT_163242 [Pseudocer... 121 8e-31 XP_007673569.1 hypothetical protein BAUCODRAFT_31440 [Baudoinia ... 121 1e-30 KEQ66746.1 RNA-binding domain-containing protein [Aureobasidium ... 120 2e-30 XP_013345411.1 hypothetical protein AUEXF2481DRAFT_38373 [Aureob... 120 3e-30 XP_013425063.1 RNP domain protein [Aureobasidium namibiae CBS 14... 120 3e-30 EME45270.1 hypothetical protein DOTSEDRAFT_71093 [Dothistroma se... 120 3e-30 KXL49983.1 hypothetical protein FE78DRAFT_138879 [Acidomyces ric... 119 8e-30 XP_007587197.1 putative rnp domain protein [Neofusicoccum parvum... 114 4e-28 XP_020132323.1 rnp domain protein [Diplodia corticola] OJD36063.... 114 4e-28 OMP83469.1 Embryonic polyadenylate-binding protein B [Diplodia s... 113 1e-27 EKG10941.1 hypothetical protein MPH_11944 [Macrophomina phaseoli... 113 1e-27 KKY23344.1 putative rnp domain protein [Diplodia seriata] 113 2e-27 OCK87656.1 RNA-binding domain-containing protein [Cenococcum geo... 112 2e-27 OCL11491.1 RNA-binding domain-containing protein [Glonium stella... 112 3e-27 >KJY01845.1 rnp domain protein [Zymoseptoria brevis] Length = 344 Score = 127 bits (318), Expect = 4e-33 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = -2 Query: 343 EFFQDYLVETTSIPTNPRTTRPVGYAFVDVSTPTEAERAIENLNGKTILDRKVSVQLARK 164 EFF+DYLVETTSIPTNPRTTRPVGYAFVDVSTPTEAERAIENLNGKTILDRKVSVQLARK Sbjct: 63 EFFKDYLVETTSIPTNPRTTRPVGYAFVDVSTPTEAERAIENLNGKTILDRKVSVQLARK 122 Query: 163 PEP 155 PEP Sbjct: 123 PEP 125 >XP_003853884.1 hypothetical protein MYCGRDRAFT_103773 [Zymoseptoria tritici IPO323] EGP88860.1 hypothetical protein MYCGRDRAFT_103773 [Zymoseptoria tritici IPO323] Length = 344 Score = 127 bits (318), Expect = 4e-33 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = -2 Query: 343 EFFQDYLVETTSIPTNPRTTRPVGYAFVDVSTPTEAERAIENLNGKTILDRKVSVQLARK 164 EFF+DYLVETTSIPTNPRTTRPVGYAFVDVSTPTEAERAIENLNGKTILDRKVSVQLARK Sbjct: 63 EFFKDYLVETTSIPTNPRTTRPVGYAFVDVSTPTEAERAIENLNGKTILDRKVSVQLARK 122 Query: 163 PEP 155 PEP Sbjct: 123 PEP 125 >XP_016758640.1 RNP domain protein [Sphaerulina musiva SO2202] EMF10519.1 RNP domain protein [Sphaerulina musiva SO2202] Length = 374 Score = 124 bits (312), Expect = 5e-32 Identities = 61/63 (96%), Positives = 62/63 (98%) Frame = -2 Query: 343 EFFQDYLVETTSIPTNPRTTRPVGYAFVDVSTPTEAERAIENLNGKTILDRKVSVQLARK 164 EFFQDYLVETTSIPTNPRTTRPVGYAFVDVSTPTEAERAI +LNGKTILDRKVSVQLARK Sbjct: 69 EFFQDYLVETTSIPTNPRTTRPVGYAFVDVSTPTEAERAINDLNGKTILDRKVSVQLARK 128 Query: 163 PEP 155 PEP Sbjct: 129 PEP 131 >KEQ89618.1 RNA-binding domain-containing protein [Aureobasidium pullulans EXF-150] Length = 370 Score = 121 bits (304), Expect = 7e-31 Identities = 59/63 (93%), Positives = 61/63 (96%) Frame = -2 Query: 343 EFFQDYLVETTSIPTNPRTTRPVGYAFVDVSTPTEAERAIENLNGKTILDRKVSVQLARK 164 +FF+DYLVETTSIPTNPRTTRPVGYAFVDVSTPTEAERAI LNGKTILDRKVSVQLARK Sbjct: 69 DFFKDYLVETTSIPTNPRTTRPVGYAFVDVSTPTEAERAISELNGKTILDRKVSVQLARK 128 Query: 163 PEP 155 PEP Sbjct: 129 PEP 131 >KXT17638.1 hypothetical protein AC579_10153 [Pseudocercospora musae] Length = 380 Score = 121 bits (304), Expect = 8e-31 Identities = 59/63 (93%), Positives = 62/63 (98%) Frame = -2 Query: 343 EFFQDYLVETTSIPTNPRTTRPVGYAFVDVSTPTEAERAIENLNGKTILDRKVSVQLARK 164 EFF+DYLVETTSIPTNPRTTRPVGYAFVDVSTP+EAERAI +LNGKTILDRKVSVQLARK Sbjct: 69 EFFKDYLVETTSIPTNPRTTRPVGYAFVDVSTPSEAERAINDLNGKTILDRKVSVQLARK 128 Query: 163 PEP 155 PEP Sbjct: 129 PEP 131 >KXT03719.1 hypothetical protein AC578_5142 [Mycosphaerella eumusae] Length = 380 Score = 121 bits (304), Expect = 8e-31 Identities = 59/63 (93%), Positives = 62/63 (98%) Frame = -2 Query: 343 EFFQDYLVETTSIPTNPRTTRPVGYAFVDVSTPTEAERAIENLNGKTILDRKVSVQLARK 164 EFF+DYLVETTSIPTNPRTTRPVGYAFVDVSTP+EAERAI +LNGKTILDRKVSVQLARK Sbjct: 69 EFFKDYLVETTSIPTNPRTTRPVGYAFVDVSTPSEAERAINDLNGKTILDRKVSVQLARK 128 Query: 163 PEP 155 PEP Sbjct: 129 PEP 131 >XP_007925052.1 hypothetical protein MYCFIDRAFT_163242 [Pseudocercospora fijiensis CIRAD86] EME84428.1 hypothetical protein MYCFIDRAFT_163242 [Pseudocercospora fijiensis CIRAD86] Length = 380 Score = 121 bits (304), Expect = 8e-31 Identities = 59/63 (93%), Positives = 62/63 (98%) Frame = -2 Query: 343 EFFQDYLVETTSIPTNPRTTRPVGYAFVDVSTPTEAERAIENLNGKTILDRKVSVQLARK 164 EFF+DYLVETTSIPTNPRTTRPVGYAFVDVSTP+EAERAI +LNGKTILDRKVSVQLARK Sbjct: 69 EFFKDYLVETTSIPTNPRTTRPVGYAFVDVSTPSEAERAINDLNGKTILDRKVSVQLARK 128 Query: 163 PEP 155 PEP Sbjct: 129 PEP 131 >XP_007673569.1 hypothetical protein BAUCODRAFT_31440 [Baudoinia panamericana UAMH 10762] EMC99132.1 hypothetical protein BAUCODRAFT_31440 [Baudoinia panamericana UAMH 10762] Length = 381 Score = 121 bits (303), Expect = 1e-30 Identities = 59/63 (93%), Positives = 61/63 (96%) Frame = -2 Query: 343 EFFQDYLVETTSIPTNPRTTRPVGYAFVDVSTPTEAERAIENLNGKTILDRKVSVQLARK 164 EFF+DYLVETTSIPTNPRTTRPVGYAFVDVSTP+EAERAI LNGKTILDRKVSVQLARK Sbjct: 69 EFFKDYLVETTSIPTNPRTTRPVGYAFVDVSTPSEAERAINELNGKTILDRKVSVQLARK 128 Query: 163 PEP 155 PEP Sbjct: 129 PEP 131 >KEQ66746.1 RNA-binding domain-containing protein [Aureobasidium melanogenum CBS 110374] Length = 365 Score = 120 bits (300), Expect = 2e-30 Identities = 58/63 (92%), Positives = 61/63 (96%) Frame = -2 Query: 343 EFFQDYLVETTSIPTNPRTTRPVGYAFVDVSTPTEAERAIENLNGKTILDRKVSVQLARK 164 +FF+DYLVETTSIPTNPRTTRPVGYAFVDVSTP+EAERAI LNGKTILDRKVSVQLARK Sbjct: 69 DFFKDYLVETTSIPTNPRTTRPVGYAFVDVSTPSEAERAISELNGKTILDRKVSVQLARK 128 Query: 163 PEP 155 PEP Sbjct: 129 PEP 131 >XP_013345411.1 hypothetical protein AUEXF2481DRAFT_38373 [Aureobasidium subglaciale EXF-2481] KEQ96970.1 hypothetical protein AUEXF2481DRAFT_38373 [Aureobasidium subglaciale EXF-2481] Length = 370 Score = 120 bits (300), Expect = 3e-30 Identities = 58/63 (92%), Positives = 61/63 (96%) Frame = -2 Query: 343 EFFQDYLVETTSIPTNPRTTRPVGYAFVDVSTPTEAERAIENLNGKTILDRKVSVQLARK 164 +FF+DYLVETTSIPTNPRTTRPVGYAFVDVSTP+EAERAI LNGKTILDRKVSVQLARK Sbjct: 69 DFFKDYLVETTSIPTNPRTTRPVGYAFVDVSTPSEAERAISELNGKTILDRKVSVQLARK 128 Query: 163 PEP 155 PEP Sbjct: 129 PEP 131 >XP_013425063.1 RNP domain protein [Aureobasidium namibiae CBS 147.97] KEQ71075.1 RNP domain protein [Aureobasidium namibiae CBS 147.97] Length = 370 Score = 120 bits (300), Expect = 3e-30 Identities = 58/63 (92%), Positives = 61/63 (96%) Frame = -2 Query: 343 EFFQDYLVETTSIPTNPRTTRPVGYAFVDVSTPTEAERAIENLNGKTILDRKVSVQLARK 164 +FF+DYLVETTSIPTNPRTTRPVGYAFVDVSTP+EAERAI LNGKTILDRKVSVQLARK Sbjct: 69 DFFKDYLVETTSIPTNPRTTRPVGYAFVDVSTPSEAERAISELNGKTILDRKVSVQLARK 128 Query: 163 PEP 155 PEP Sbjct: 129 PEP 131 >EME45270.1 hypothetical protein DOTSEDRAFT_71093 [Dothistroma septosporum NZE10] Length = 379 Score = 120 bits (300), Expect = 3e-30 Identities = 58/63 (92%), Positives = 62/63 (98%) Frame = -2 Query: 343 EFFQDYLVETTSIPTNPRTTRPVGYAFVDVSTPTEAERAIENLNGKTILDRKVSVQLARK 164 EFF++YLVETTSIPTNPRTTRPVGYAFVDVSTP+EAERAI +LNGKTILDRKVSVQLARK Sbjct: 69 EFFKEYLVETTSIPTNPRTTRPVGYAFVDVSTPSEAERAINDLNGKTILDRKVSVQLARK 128 Query: 163 PEP 155 PEP Sbjct: 129 PEP 131 >KXL49983.1 hypothetical protein FE78DRAFT_138879 [Acidomyces richmondensis] KYG45934.1 hypothetical protein M433DRAFT_66222 [Acidomyces richmondensis BFW] Length = 375 Score = 119 bits (297), Expect = 8e-30 Identities = 57/63 (90%), Positives = 61/63 (96%) Frame = -2 Query: 343 EFFQDYLVETTSIPTNPRTTRPVGYAFVDVSTPTEAERAIENLNGKTILDRKVSVQLARK 164 +FF+DYLVETTSIPTNPRTTRPVGYAFVDVSTP+EA+RAI LNGKTILDRKVSVQLARK Sbjct: 65 DFFKDYLVETTSIPTNPRTTRPVGYAFVDVSTPSEAQRAINELNGKTILDRKVSVQLARK 124 Query: 163 PEP 155 PEP Sbjct: 125 PEP 127 >XP_007587197.1 putative rnp domain protein [Neofusicoccum parvum UCRNP2] EOD45339.1 putative rnp domain protein [Neofusicoccum parvum UCRNP2] Length = 387 Score = 114 bits (286), Expect = 4e-28 Identities = 55/62 (88%), Positives = 59/62 (95%) Frame = -2 Query: 343 EFFQDYLVETTSIPTNPRTTRPVGYAFVDVSTPTEAERAIENLNGKTILDRKVSVQLARK 164 EFF+DYLVE+TSIPTNPRTTRPVGYAFVD+STPTEAERAI LNGK ILDRKVS+QLARK Sbjct: 72 EFFKDYLVESTSIPTNPRTTRPVGYAFVDLSTPTEAERAITELNGKAILDRKVSIQLARK 131 Query: 163 PE 158 PE Sbjct: 132 PE 133 >XP_020132323.1 rnp domain protein [Diplodia corticola] OJD36063.1 rnp domain protein [Diplodia corticola] Length = 403 Score = 114 bits (286), Expect = 4e-28 Identities = 55/62 (88%), Positives = 59/62 (95%) Frame = -2 Query: 343 EFFQDYLVETTSIPTNPRTTRPVGYAFVDVSTPTEAERAIENLNGKTILDRKVSVQLARK 164 EFF+DYLVE+TSIPTNPRTTRPVGYAFVD+STPTEAERAI LNGK ILDRKVS+QLARK Sbjct: 72 EFFKDYLVESTSIPTNPRTTRPVGYAFVDLSTPTEAERAITELNGKAILDRKVSIQLARK 131 Query: 163 PE 158 PE Sbjct: 132 PE 133 >OMP83469.1 Embryonic polyadenylate-binding protein B [Diplodia seriata] Length = 386 Score = 113 bits (282), Expect = 1e-27 Identities = 54/62 (87%), Positives = 59/62 (95%) Frame = -2 Query: 343 EFFQDYLVETTSIPTNPRTTRPVGYAFVDVSTPTEAERAIENLNGKTILDRKVSVQLARK 164 EFF+DYLVE+TSIPTNPRTTRPVGYAFVD+STP+EAERAI LNGK ILDRKVS+QLARK Sbjct: 72 EFFKDYLVESTSIPTNPRTTRPVGYAFVDLSTPSEAERAITELNGKAILDRKVSIQLARK 131 Query: 163 PE 158 PE Sbjct: 132 PE 133 >EKG10941.1 hypothetical protein MPH_11944 [Macrophomina phaseolina MS6] Length = 387 Score = 113 bits (282), Expect = 1e-27 Identities = 54/62 (87%), Positives = 59/62 (95%) Frame = -2 Query: 343 EFFQDYLVETTSIPTNPRTTRPVGYAFVDVSTPTEAERAIENLNGKTILDRKVSVQLARK 164 EFF+DYLVE+TSIPTNPRTTRPVGYAFVD+STP+EAERAI LNGK ILDRKVS+QLARK Sbjct: 72 EFFKDYLVESTSIPTNPRTTRPVGYAFVDLSTPSEAERAIAELNGKAILDRKVSIQLARK 131 Query: 163 PE 158 PE Sbjct: 132 PE 133 >KKY23344.1 putative rnp domain protein [Diplodia seriata] Length = 399 Score = 113 bits (282), Expect = 2e-27 Identities = 54/62 (87%), Positives = 59/62 (95%) Frame = -2 Query: 343 EFFQDYLVETTSIPTNPRTTRPVGYAFVDVSTPTEAERAIENLNGKTILDRKVSVQLARK 164 EFF+DYLVE+TSIPTNPRTTRPVGYAFVD+STP+EAERAI LNGK ILDRKVS+QLARK Sbjct: 72 EFFKDYLVESTSIPTNPRTTRPVGYAFVDLSTPSEAERAITELNGKAILDRKVSIQLARK 131 Query: 163 PE 158 PE Sbjct: 132 PE 133 >OCK87656.1 RNA-binding domain-containing protein [Cenococcum geophilum 1.58] Length = 379 Score = 112 bits (281), Expect = 2e-27 Identities = 54/62 (87%), Positives = 59/62 (95%) Frame = -2 Query: 343 EFFQDYLVETTSIPTNPRTTRPVGYAFVDVSTPTEAERAIENLNGKTILDRKVSVQLARK 164 EFF+DYLVE+TSIPTNPRTTRPVGYAFVD+STP+EAERAI LNGK ILDRKVS+QLARK Sbjct: 71 EFFKDYLVESTSIPTNPRTTRPVGYAFVDLSTPSEAERAIVELNGKAILDRKVSIQLARK 130 Query: 163 PE 158 PE Sbjct: 131 PE 132 >OCL11491.1 RNA-binding domain-containing protein [Glonium stellatum] Length = 379 Score = 112 bits (279), Expect = 3e-27 Identities = 53/62 (85%), Positives = 59/62 (95%) Frame = -2 Query: 343 EFFQDYLVETTSIPTNPRTTRPVGYAFVDVSTPTEAERAIENLNGKTILDRKVSVQLARK 164 EFF+DYLVE+TSIPTNPRTTRPVGYAFVD+STP+EA+RAI LNGK ILDRKVS+QLARK Sbjct: 71 EFFKDYLVESTSIPTNPRTTRPVGYAFVDLSTPSEADRAIAELNGKAILDRKVSIQLARK 130 Query: 163 PE 158 PE Sbjct: 131 PE 132