BLASTX nr result
ID: Phellodendron21_contig00035149
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00035149 (343 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007415336.1 hypothetical protein MELLADRAFT_79007 [Melampsora... 56 1e-06 >XP_007415336.1 hypothetical protein MELLADRAFT_79007 [Melampsora larici-populina 98AG31] EGG01486.1 hypothetical protein MELLADRAFT_79007 [Melampsora larici-populina 98AG31] Length = 647 Score = 55.8 bits (133), Expect = 1e-06 Identities = 42/92 (45%), Positives = 53/92 (57%), Gaps = 4/92 (4%) Frame = -2 Query: 333 YASPPTTCVLPHEFVSFDAPPGAQDHESSFEIHQKRPKLLSNASNSHLGHCQPSSTLHVS 154 + SPP V EFV FD+ FE + KRPKL + SN+ L +PS S Sbjct: 214 HISPPN--VSGREFVQFDSTLNHCSPLDQFEPNSKRPKLSQSTSNNPL--LRPSQLSTSS 269 Query: 153 PK-RGIGESG--SILDQHMSM-MTQQQTNKRR 70 PK R + ESG SILDQHMSM ++QQQ N++R Sbjct: 270 PKHRALTESGSNSILDQHMSMLLSQQQINQKR 301