BLASTX nr result
ID: Phellodendron21_contig00035148
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00035148 (559 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006465325.2 PREDICTED: putative F-box/FBD/LRR-repeat protein ... 52 7e-13 >XP_006465325.2 PREDICTED: putative F-box/FBD/LRR-repeat protein At4g26350 [Citrus sinensis] KDO48552.1 hypothetical protein CISIN_1g037298mg [Citrus sinensis] Length = 154 Score = 52.4 bits (124), Expect(3) = 7e-13 Identities = 33/51 (64%), Positives = 35/51 (68%), Gaps = 3/51 (5%) Frame = -2 Query: 378 YQGISSE--VVKFLLRNVLVLEKRIIYSPLLSLDEERML-QETIFGYTRGS 235 +QG E VVKFLL N VLEK +I SP LS DEE ML ETIFGY RGS Sbjct: 93 FQGKQYELTVVKFLLGNAEVLEKMVICSPPLSSDEETMLISETIFGYPRGS 143 Score = 45.8 bits (107), Expect(3) = 7e-13 Identities = 24/35 (68%), Positives = 24/35 (68%), Gaps = 2/35 (5%) Frame = -3 Query: 455 FVCDYW--R**EPESVPTCMSNCLKQIGIKGFQAK 357 FVCD W R EPE VP M NCLK IGIKGFQ K Sbjct: 62 FVCDEWLRRWREPEPVPKGMLNCLKVIGIKGFQGK 96 Score = 22.3 bits (46), Expect(3) = 7e-13 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 256 IWVYKRLCAACQVIFFSDS 200 I+ Y R CQ+IF SDS Sbjct: 136 IFGYPRGSKDCQIIFLSDS 154