BLASTX nr result
ID: Phellodendron21_contig00035132
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00035132 (309 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007411614.1 hypothetical protein MELLADRAFT_78151 [Melampsora... 63 2e-09 >XP_007411614.1 hypothetical protein MELLADRAFT_78151 [Melampsora larici-populina 98AG31] EGG05249.1 hypothetical protein MELLADRAFT_78151 [Melampsora larici-populina 98AG31] Length = 570 Score = 62.8 bits (151), Expect = 2e-09 Identities = 41/95 (43%), Positives = 52/95 (54%), Gaps = 4/95 (4%) Frame = +2 Query: 8 DADSIAATPVLPPKPYGDS-FPTQGSDGVLRSTGPGNTPTDLRPGPPETNYGAES---SD 175 D D IAA + Y +S F +G+DG STGPGNTP + +P P E ++ + S Sbjct: 374 DPDPIAAAAARLRQDYDESAFYVRGADGQPVSTGPGNTPKE-QPWPHEQDHAGSNESGSH 432 Query: 176 TLPTHATHSHESNSEARAPSRAPVHRPSNPSISGS 280 T PT ATH H+ PS PVHR SN S +GS Sbjct: 433 TAPTQATHGHD-------PSHLPVHRASNLSTNGS 460