BLASTX nr result
ID: Phellodendron21_contig00035045
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00035045 (674 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007415062.1 hypothetical protein MELLADRAFT_91966 [Melampsora... 70 2e-10 >XP_007415062.1 hypothetical protein MELLADRAFT_91966 [Melampsora larici-populina 98AG31] EGG01717.1 hypothetical protein MELLADRAFT_91966 [Melampsora larici-populina 98AG31] Length = 748 Score = 70.5 bits (171), Expect = 2e-10 Identities = 44/104 (42%), Positives = 56/104 (53%), Gaps = 13/104 (12%) Frame = -1 Query: 623 PLQLEEHDRVLYNAAVANQPGFFEPVLNS------------PNGISNVGNGAHETLYPGP 480 PLQL+EHDRVLY NQ +++ V NS NGIS NG HETL+PG Sbjct: 648 PLQLDEHDRVLYTVPQVNQSTYYDQVGNSNNSNSNNSNNNNNNGISTAANGVHETLFPGS 707 Query: 479 DPSPTLGNLQNNSRDHVSFPSLFGSGLAFEEAEAEN-SPAEGAF 351 D SP L + + D + F S LAFEE E ++ +EG+F Sbjct: 708 DSSP----LIDMTNDRSGLSTHFRSRLAFEETEPDHLVTSEGSF 747