BLASTX nr result
ID: Phellodendron21_contig00034981
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00034981 (257 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO54155.1 hypothetical protein CISIN_1g029228mg [Citrus sinensis] 69 2e-12 XP_006476104.1 PREDICTED: uncharacterized protein LOC102626596 [... 69 2e-12 KDO36797.1 hypothetical protein CISIN_1g034206mg [Citrus sinensis] 59 2e-09 XP_006451093.1 hypothetical protein CICLE_v10010311mg [Citrus cl... 60 8e-09 XP_007206919.1 hypothetical protein PRUPE_ppb014879mg, partial [... 59 2e-08 EPS62193.1 hypothetical protein M569_12601, partial [Genlisea au... 57 3e-08 ONI04109.1 hypothetical protein PRUPE_6G303100 [Prunus persica] 57 9e-08 ABG34280.1 pectin acetylesterase, partial [Eucalyptus globulus s... 57 1e-07 CBI39680.3 unnamed protein product, partial [Vitis vinifera] 57 1e-07 XP_006423958.1 hypothetical protein CICLE_v10028674mg [Citrus cl... 57 1e-07 KZM81690.1 hypothetical protein DCAR_029303 [Daucus carota subsp... 57 1e-07 XP_017237097.1 PREDICTED: pectin acetylesterase 12-like [Daucus ... 57 1e-07 XP_018505091.1 PREDICTED: pectin acetylesterase 10-like [Pyrus x... 57 1e-07 XP_008363955.1 PREDICTED: pectin acetylesterase 10-like [Malus d... 57 1e-07 ONI04108.1 hypothetical protein PRUPE_6G303100 [Prunus persica] 57 1e-07 XP_017224374.1 PREDICTED: pectin acetylesterase 10 [Daucus carot... 57 1e-07 XP_008246334.1 PREDICTED: pectin acetylesterase 12 isoform X2 [P... 57 1e-07 XP_015874830.1 PREDICTED: pectin acetylesterase 12 [Ziziphus juj... 57 1e-07 XP_004302322.1 PREDICTED: pectin acetylesterase 12-like [Fragari... 57 1e-07 OAY43901.1 hypothetical protein MANES_08G106800 [Manihot esculenta] 57 1e-07 >KDO54155.1 hypothetical protein CISIN_1g029228mg [Citrus sinensis] Length = 197 Score = 68.6 bits (166), Expect = 2e-12 Identities = 36/50 (72%), Positives = 39/50 (78%) Frame = -2 Query: 196 GSFS*RWTLHERFRALRDERKWMLDKFE*MKVQETYDNKFIAFAEVLSSC 47 G S RWTL ERFRAL +ERKW DKFE MKVQ++YDN AFAEVLSSC Sbjct: 150 GRGSSRWTLDERFRALCEERKWKHDKFEQMKVQDSYDNN--AFAEVLSSC 197 >XP_006476104.1 PREDICTED: uncharacterized protein LOC102626596 [Citrus sinensis] Length = 197 Score = 68.6 bits (166), Expect = 2e-12 Identities = 36/50 (72%), Positives = 39/50 (78%) Frame = -2 Query: 196 GSFS*RWTLHERFRALRDERKWMLDKFE*MKVQETYDNKFIAFAEVLSSC 47 G S RWTL ERFRAL +ERKW DKFE MKVQ++YDN AFAEVLSSC Sbjct: 150 GRGSSRWTLDERFRALCEERKWKHDKFEQMKVQDSYDNN--AFAEVLSSC 197 >KDO36797.1 hypothetical protein CISIN_1g034206mg [Citrus sinensis] Length = 101 Score = 58.9 bits (141), Expect = 2e-09 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -1 Query: 257 LDGTLPGCHLHRGYGSGANSWLIQLEV 177 LDGTLPG HLHRGYGSGANSWLIQLEV Sbjct: 74 LDGTLPGYHLHRGYGSGANSWLIQLEV 100 >XP_006451093.1 hypothetical protein CICLE_v10010311mg [Citrus clementina] ESR64333.1 hypothetical protein CICLE_v10010311mg [Citrus clementina] Length = 644 Score = 60.5 bits (145), Expect = 8e-09 Identities = 32/46 (69%), Positives = 35/46 (76%) Frame = -2 Query: 196 GSFS*RWTLHERFRALRDERKWMLDKFE*MKVQETYDNKFIAFAEV 59 G S RWTL ERFRAL +ERKW DKFE MKVQ++YDN AFAEV Sbjct: 150 GRGSSRWTLDERFRALCEERKWKHDKFEQMKVQDSYDNN--AFAEV 193 >XP_007206919.1 hypothetical protein PRUPE_ppb014879mg, partial [Prunus persica] Length = 286 Score = 59.3 bits (142), Expect = 2e-08 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -1 Query: 257 LDGTLPGCHLHRGYGSGANSWLIQLEVDAS 168 LDGTLPG HLHRGYGSGANSWLIQLEV S Sbjct: 163 LDGTLPGYHLHRGYGSGANSWLIQLEVCCS 192 >EPS62193.1 hypothetical protein M569_12601, partial [Genlisea aurea] Length = 180 Score = 57.4 bits (137), Expect = 3e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 257 LDGTLPGCHLHRGYGSGANSWLIQLE 180 LDGTLPG HLHRGYGSGANSWLIQLE Sbjct: 55 LDGTLPGYHLHRGYGSGANSWLIQLE 80 >ONI04109.1 hypothetical protein PRUPE_6G303100 [Prunus persica] Length = 337 Score = 57.4 bits (137), Expect = 9e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 257 LDGTLPGCHLHRGYGSGANSWLIQLE 180 LDGTLPG HLHRGYGSGANSWLIQLE Sbjct: 65 LDGTLPGYHLHRGYGSGANSWLIQLE 90 >ABG34280.1 pectin acetylesterase, partial [Eucalyptus globulus subsp. globulus] Length = 350 Score = 57.4 bits (137), Expect = 1e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 257 LDGTLPGCHLHRGYGSGANSWLIQLE 180 LDGTLPG HLHRGYGSGANSWLIQLE Sbjct: 2 LDGTLPGYHLHRGYGSGANSWLIQLE 27 >CBI39680.3 unnamed protein product, partial [Vitis vinifera] Length = 365 Score = 57.4 bits (137), Expect = 1e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 257 LDGTLPGCHLHRGYGSGANSWLIQLE 180 LDGTLPG HLHRGYGSGANSWLIQLE Sbjct: 18 LDGTLPGYHLHRGYGSGANSWLIQLE 43 >XP_006423958.1 hypothetical protein CICLE_v10028674mg [Citrus clementina] ESR37198.1 hypothetical protein CICLE_v10028674mg [Citrus clementina] Length = 375 Score = 57.4 bits (137), Expect = 1e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 257 LDGTLPGCHLHRGYGSGANSWLIQLE 180 LDGTLPG HLHRGYGSGANSWLIQLE Sbjct: 26 LDGTLPGYHLHRGYGSGANSWLIQLE 51 >KZM81690.1 hypothetical protein DCAR_029303 [Daucus carota subsp. sativus] Length = 389 Score = 57.4 bits (137), Expect = 1e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 257 LDGTLPGCHLHRGYGSGANSWLIQLE 180 LDGTLPG HLHRGYGSGANSWLIQLE Sbjct: 68 LDGTLPGYHLHRGYGSGANSWLIQLE 93 >XP_017237097.1 PREDICTED: pectin acetylesterase 12-like [Daucus carota subsp. sativus] KZN05755.1 hypothetical protein DCAR_006592 [Daucus carota subsp. sativus] Length = 414 Score = 57.4 bits (137), Expect = 1e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 257 LDGTLPGCHLHRGYGSGANSWLIQLE 180 LDGTLPG HLHRGYGSGANSWLIQLE Sbjct: 67 LDGTLPGYHLHRGYGSGANSWLIQLE 92 >XP_018505091.1 PREDICTED: pectin acetylesterase 10-like [Pyrus x bretschneideri] Length = 414 Score = 57.4 bits (137), Expect = 1e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 257 LDGTLPGCHLHRGYGSGANSWLIQLE 180 LDGTLPG HLHRGYGSGANSWLIQLE Sbjct: 65 LDGTLPGYHLHRGYGSGANSWLIQLE 90 >XP_008363955.1 PREDICTED: pectin acetylesterase 10-like [Malus domestica] Length = 414 Score = 57.4 bits (137), Expect = 1e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 257 LDGTLPGCHLHRGYGSGANSWLIQLE 180 LDGTLPG HLHRGYGSGANSWLIQLE Sbjct: 65 LDGTLPGYHLHRGYGSGANSWLIQLE 90 >ONI04108.1 hypothetical protein PRUPE_6G303100 [Prunus persica] Length = 415 Score = 57.4 bits (137), Expect = 1e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 257 LDGTLPGCHLHRGYGSGANSWLIQLE 180 LDGTLPG HLHRGYGSGANSWLIQLE Sbjct: 65 LDGTLPGYHLHRGYGSGANSWLIQLE 90 >XP_017224374.1 PREDICTED: pectin acetylesterase 10 [Daucus carota subsp. sativus] Length = 415 Score = 57.4 bits (137), Expect = 1e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 257 LDGTLPGCHLHRGYGSGANSWLIQLE 180 LDGTLPG HLHRGYGSGANSWLIQLE Sbjct: 68 LDGTLPGYHLHRGYGSGANSWLIQLE 93 >XP_008246334.1 PREDICTED: pectin acetylesterase 12 isoform X2 [Prunus mume] Length = 415 Score = 57.4 bits (137), Expect = 1e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 257 LDGTLPGCHLHRGYGSGANSWLIQLE 180 LDGTLPG HLHRGYGSGANSWLIQLE Sbjct: 65 LDGTLPGYHLHRGYGSGANSWLIQLE 90 >XP_015874830.1 PREDICTED: pectin acetylesterase 12 [Ziziphus jujuba] XP_015874831.1 PREDICTED: pectin acetylesterase 12 [Ziziphus jujuba] Length = 416 Score = 57.4 bits (137), Expect = 1e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 257 LDGTLPGCHLHRGYGSGANSWLIQLE 180 LDGTLPG HLHRGYGSGANSWLIQLE Sbjct: 69 LDGTLPGYHLHRGYGSGANSWLIQLE 94 >XP_004302322.1 PREDICTED: pectin acetylesterase 12-like [Fragaria vesca subsp. vesca] Length = 417 Score = 57.4 bits (137), Expect = 1e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 257 LDGTLPGCHLHRGYGSGANSWLIQLE 180 LDGTLPG HLHRGYGSGANSWLIQLE Sbjct: 65 LDGTLPGYHLHRGYGSGANSWLIQLE 90 >OAY43901.1 hypothetical protein MANES_08G106800 [Manihot esculenta] Length = 418 Score = 57.4 bits (137), Expect = 1e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 257 LDGTLPGCHLHRGYGSGANSWLIQLE 180 LDGTLPG HLHRGYGSGANSWLIQLE Sbjct: 71 LDGTLPGYHLHRGYGSGANSWLIQLE 96