BLASTX nr result
ID: Phellodendron21_contig00034921
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00034921 (487 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007405151.1 hypothetical protein MELLADRAFT_70846 [Melampsora... 54 5e-07 >XP_007405151.1 hypothetical protein MELLADRAFT_70846 [Melampsora larici-populina 98AG31] EGG11516.1 hypothetical protein MELLADRAFT_70846 [Melampsora larici-populina 98AG31] Length = 73 Score = 54.3 bits (129), Expect = 5e-07 Identities = 32/66 (48%), Positives = 38/66 (57%), Gaps = 1/66 (1%) Frame = +2 Query: 215 MPTITSGGLFSTQKDTPPPDFSQLIRSGQQML-LQAIQNDELTKSPINSPVATASSTATD 391 MPTITSGGLFS Q + P+FS+LI SGQQ+L Q QN S TA S A+ Sbjct: 1 MPTITSGGLFSNQARSKKPEFSELIWSGQQLLHQQTTQNQSAESSKELVKRNTAGSVASS 60 Query: 392 NCNARD 409 C + D Sbjct: 61 ECGSDD 66