BLASTX nr result
ID: Phellodendron21_contig00034905
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00034905 (304 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007412560.1 hypothetical protein MELLADRAFT_108727 [Melampsor... 73 2e-13 >XP_007412560.1 hypothetical protein MELLADRAFT_108727 [Melampsora larici-populina 98AG31] EGG04099.1 hypothetical protein MELLADRAFT_108727 [Melampsora larici-populina 98AG31] Length = 256 Score = 73.2 bits (178), Expect = 2e-13 Identities = 37/73 (50%), Positives = 53/73 (72%) Frame = -1 Query: 283 QIQSNFKRIHPLNEYCNEEISDEEATEAFTLSQAEQINLIEKTGILSRIPMSKPSQVPRE 104 Q+ S K P + +++ E ++ F +SQA+Q+ LIE+TGILSRIPMSKPSQ R+ Sbjct: 24 QVTSIKKDNQPRIQSDDDDSGAESSSGLFDISQADQMKLIEQTGILSRIPMSKPSQTKRD 83 Query: 103 ARKPLLEFSQHEI 65 ++KPLLEF++HEI Sbjct: 84 SQKPLLEFAKHEI 96