BLASTX nr result
ID: Phellodendron21_contig00034890
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00034890 (316 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007417791.1 hypothetical protein MELLADRAFT_118401 [Melampsor... 55 2e-06 >XP_007417791.1 hypothetical protein MELLADRAFT_118401 [Melampsora larici-populina 98AG31] EGF98946.1 hypothetical protein MELLADRAFT_118401 [Melampsora larici-populina 98AG31] Length = 378 Score = 54.7 bits (130), Expect = 2e-06 Identities = 32/70 (45%), Positives = 43/70 (61%), Gaps = 13/70 (18%) Frame = +3 Query: 3 ERREAIMDRFKKLG-SRVGLSEFELRGGN------DDEQQGSEHEA------LRRPKLRH 143 +RR+ ++ R+ +LG + +GLSE+ELRGG DD+ S E LRRP+ RH Sbjct: 143 QRRKQMLARYHRLGPNSIGLSEYELRGGKTETSVEDDDTSTSSPEIETAEPILRRPRFRH 202 Query: 144 HAETDAGDLV 173 HAETDA D V Sbjct: 203 HAETDAADSV 212