BLASTX nr result
ID: Phellodendron21_contig00034835
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00034835 (309 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO46326.1 hypothetical protein CISIN_1g027448mg [Citrus sinensis] 96 3e-22 KDO41209.1 hypothetical protein CISIN_1g0018601mg, partial [Citr... 91 5e-22 XP_006494846.1 PREDICTED: probable disease resistance protein At... 96 6e-21 XP_015383899.1 PREDICTED: probable disease resistance protein At... 96 8e-21 XP_015383898.1 PREDICTED: probable disease resistance protein At... 96 8e-21 XP_006471905.1 PREDICTED: probable disease resistance protein At... 90 6e-19 KDO40576.1 hypothetical protein CISIN_1g0403321mg, partial [Citr... 89 1e-18 KDO46328.1 hypothetical protein CISIN_1g029956mg [Citrus sinensis] 84 3e-18 XP_006471890.1 PREDICTED: internalin-I-like [Citrus sinensis] 88 3e-18 KDO41211.1 hypothetical protein CISIN_1g0488091mg, partial [Citr... 84 6e-18 XP_006471707.2 PREDICTED: importin subunit alpha-1a-like [Citrus... 86 3e-17 XP_015383918.1 PREDICTED: uncharacterized protein LOC102630318 [... 84 3e-17 XP_006471840.1 PREDICTED: uncharacterized protein LOC102612846 [... 84 3e-17 KDO38849.1 hypothetical protein CISIN_1g037562mg [Citrus sinensis] 85 5e-17 XP_015383917.1 PREDICTED: probable disease resistance protein At... 84 7e-17 XP_015383916.1 PREDICTED: probable disease resistance protein At... 84 7e-17 XP_006471896.1 PREDICTED: probable disease resistance protein At... 84 7e-17 XP_015383915.1 PREDICTED: probable disease resistance protein At... 84 7e-17 KDO38254.1 hypothetical protein CISIN_1g0385762mg, partial [Citr... 80 3e-16 CAN62856.1 hypothetical protein VITISV_013426 [Vitis vinifera] 79 3e-16 >KDO46326.1 hypothetical protein CISIN_1g027448mg [Citrus sinensis] Length = 223 Score = 95.5 bits (236), Expect = 3e-22 Identities = 48/87 (55%), Positives = 59/87 (67%), Gaps = 1/87 (1%) Frame = +2 Query: 8 NCTFKFLSLERLVVENCPKMKIFSGGELSTPSLGKIHRYRYKNSDWTWEDDLNTTIRHLY 187 NC FKF SLERLVV+ CP MKIFS GELSTP L K+ N W W+ DLNTTI+++Y Sbjct: 131 NCAFKFPSLERLVVDRCPNMKIFSEGELSTPKLQKVQLSWLDNKLWAWDRDLNTTIQYVY 190 Query: 188 LETMGVDKE-ENDKSTKENNAESSGKD 265 L+ +KE EN+KS + N E + KD Sbjct: 191 LKRKKEEKEKENEKSAEANEKEKNVKD 217 >KDO41209.1 hypothetical protein CISIN_1g0018601mg, partial [Citrus sinensis] Length = 93 Score = 91.3 bits (225), Expect = 5e-22 Identities = 44/72 (61%), Positives = 50/72 (69%) Frame = +2 Query: 8 NCTFKFLSLERLVVENCPKMKIFSGGELSTPSLGKIHRYRYKNSDWTWEDDLNTTIRHLY 187 NC FKF SLERLVVE+CP MKIFSGGELSTP L K+ W W+ DLNTTIR+LY Sbjct: 12 NCAFKFPSLERLVVEDCPNMKIFSGGELSTPKLHKVQLNYIDEKRWAWDRDLNTTIRYLY 71 Query: 188 LETMGVDKEEND 223 L T V E++ Sbjct: 72 LTTKRVQTYEDN 83 >XP_006494846.1 PREDICTED: probable disease resistance protein At4g27220 [Citrus sinensis] Length = 1227 Score = 95.9 bits (237), Expect = 6e-21 Identities = 48/87 (55%), Positives = 58/87 (66%), Gaps = 1/87 (1%) Frame = +2 Query: 8 NCTFKFLSLERLVVENCPKMKIFSGGELSTPSLGKIHRYRYKNSDWTWEDDLNTTIRHLY 187 NC FKF SLERLVV+ CP MKIFS GELSTP L K+ N W W+ DLNTTI+++Y Sbjct: 1135 NCDFKFPSLERLVVDRCPNMKIFSEGELSTPKLQKVQLSWLDNKLWAWDRDLNTTIQYVY 1194 Query: 188 LETMGVDKE-ENDKSTKENNAESSGKD 265 L+ +KE EN+KS + N E KD Sbjct: 1195 LKRKKEEKEKENEKSAEANEKEKDAKD 1221 >XP_015383899.1 PREDICTED: probable disease resistance protein At4g27220 isoform X2 [Citrus sinensis] Length = 1223 Score = 95.5 bits (236), Expect = 8e-21 Identities = 48/87 (55%), Positives = 59/87 (67%), Gaps = 1/87 (1%) Frame = +2 Query: 8 NCTFKFLSLERLVVENCPKMKIFSGGELSTPSLGKIHRYRYKNSDWTWEDDLNTTIRHLY 187 NC FKF SLERLVV+ CP MKIFS GELSTP L K+ N W W+ DLNTTI+++Y Sbjct: 1131 NCAFKFPSLERLVVDRCPNMKIFSEGELSTPKLQKVQLSWLDNKLWAWDRDLNTTIQYVY 1190 Query: 188 LETMGVDKE-ENDKSTKENNAESSGKD 265 L+ +KE EN+KS + N E + KD Sbjct: 1191 LKRKKEEKEKENEKSAEANEKEKNVKD 1217 >XP_015383898.1 PREDICTED: probable disease resistance protein At4g27220 isoform X1 [Citrus sinensis] Length = 1229 Score = 95.5 bits (236), Expect = 8e-21 Identities = 48/87 (55%), Positives = 59/87 (67%), Gaps = 1/87 (1%) Frame = +2 Query: 8 NCTFKFLSLERLVVENCPKMKIFSGGELSTPSLGKIHRYRYKNSDWTWEDDLNTTIRHLY 187 NC FKF SLERLVV+ CP MKIFS GELSTP L K+ N W W+ DLNTTI+++Y Sbjct: 1131 NCAFKFPSLERLVVDRCPNMKIFSEGELSTPKLQKVQLSWLDNKLWAWDRDLNTTIQYVY 1190 Query: 188 LETMGVDKE-ENDKSTKENNAESSGKD 265 L+ +KE EN+KS + N E + KD Sbjct: 1191 LKRKKEEKEKENEKSAEANEKEKNVKD 1217 >XP_006471905.1 PREDICTED: probable disease resistance protein At4g27220 [Citrus sinensis] Length = 1239 Score = 90.1 bits (222), Expect = 6e-19 Identities = 45/87 (51%), Positives = 56/87 (64%), Gaps = 1/87 (1%) Frame = +2 Query: 8 NCTFKFLSLERLVVENCPKMKIFSGGELSTPSLGKIHRYRYKNSDWTWEDDLNTTIRHLY 187 NC FKF SLERL+V NCP MKIFS GELSTP L K+ W W+ DLNTTI+++Y Sbjct: 1147 NCDFKFPSLERLMVHNCPNMKIFSKGELSTPKLQKVQLSLVDEKLWAWDRDLNTTIQYVY 1206 Query: 188 LETMGVDKE-ENDKSTKENNAESSGKD 265 L+ ++E E +KS K N E K+ Sbjct: 1207 LKRKKEEEEKEKEKSAKANEKEKDAKN 1233 >KDO40576.1 hypothetical protein CISIN_1g0403321mg, partial [Citrus sinensis] Length = 420 Score = 89.0 bits (219), Expect = 1e-18 Identities = 41/65 (63%), Positives = 49/65 (75%) Frame = +2 Query: 2 SGNCTFKFLSLERLVVENCPKMKIFSGGELSTPSLGKIHRYRYKNSDWTWEDDLNTTIRH 181 SG+C FKF SLER++V +CP MKIFSGGELSTP L K+ + WTWE DLNTTI+ Sbjct: 351 SGHCAFKFPSLERILVNDCPSMKIFSGGELSTPKLLKVQLDEFNKELWTWERDLNTTIQT 410 Query: 182 LYLET 196 LYL+T Sbjct: 411 LYLKT 415 >KDO46328.1 hypothetical protein CISIN_1g029956mg [Citrus sinensis] Length = 185 Score = 84.3 bits (207), Expect = 3e-18 Identities = 39/78 (50%), Positives = 51/78 (65%) Frame = +2 Query: 2 SGNCTFKFLSLERLVVENCPKMKIFSGGELSTPSLGKIHRYRYKNSDWTWEDDLNTTIRH 181 SGNC FKF +L L V+ CP MKIFSG ELSTPSL ++ + WTW+ DLN+TI+ Sbjct: 102 SGNCAFKFPALTYLSVDKCPNMKIFSGKELSTPSLHELEKRWLSGEYWTWKGDLNSTIQQ 161 Query: 182 LYLETMGVDKEENDKSTK 235 +YLET V ++D + Sbjct: 162 IYLETKEVQNHKDDSGQR 179 >XP_006471890.1 PREDICTED: internalin-I-like [Citrus sinensis] Length = 691 Score = 88.2 bits (217), Expect = 3e-18 Identities = 45/87 (51%), Positives = 58/87 (66%), Gaps = 1/87 (1%) Frame = +2 Query: 8 NCTFKFLSLERLVVENCPKMKIFSGGELSTPSLGKIHRYRYKNSD-WTWEDDLNTTIRHL 184 NC FKF SLERLVVE+CP M IFSGGELSTP L K+ + + T + DLNTTI++L Sbjct: 567 NCNFKFPSLERLVVEDCPNMNIFSGGELSTPKLRKVELKEFGDEGCQTLDHDLNTTIQYL 626 Query: 185 YLETMGVDKEENDKSTKENNAESSGKD 265 YL+ ++EN+ ++EN E KD Sbjct: 627 YLKNKPEKEKENETFSEENEKEEDAKD 653 >KDO41211.1 hypothetical protein CISIN_1g0488091mg, partial [Citrus sinensis] Length = 223 Score = 84.3 bits (207), Expect = 6e-18 Identities = 39/61 (63%), Positives = 48/61 (78%), Gaps = 1/61 (1%) Frame = +2 Query: 8 NCTFKFLSLERLVVENCPKMKIFSGGELSTPSLGKIHRYRYKNSD-WTWEDDLNTTIRHL 184 NC FKF SLERLVVE+CP M IFSGGELSTP+L K+ ++ + W W+DDLNTTI++L Sbjct: 160 NCAFKFPSLERLVVEDCPNMSIFSGGELSTPNLRKVQLKQWDDEKRWAWKDDLNTTIQYL 219 Query: 185 Y 187 Y Sbjct: 220 Y 220 >XP_006471707.2 PREDICTED: importin subunit alpha-1a-like [Citrus sinensis] Length = 668 Score = 85.5 bits (210), Expect = 3e-17 Identities = 38/67 (56%), Positives = 49/67 (73%) Frame = +2 Query: 2 SGNCTFKFLSLERLVVENCPKMKIFSGGELSTPSLGKIHRYRYKNSDWTWEDDLNTTIRH 181 +GNC FKF SL+RL++++CP MKIFSGGELSTP L K+H W W DLNT+I++ Sbjct: 146 TGNCAFKFPSLKRLLLDDCPSMKIFSGGELSTPMLHKVHLSISDGEHWIWVHDLNTSIKY 205 Query: 182 LYLETMG 202 LYL+ G Sbjct: 206 LYLKKTG 212 >XP_015383918.1 PREDICTED: uncharacterized protein LOC102630318 [Citrus sinensis] Length = 328 Score = 84.3 bits (207), Expect = 3e-17 Identities = 39/74 (52%), Positives = 50/74 (67%) Frame = +2 Query: 2 SGNCTFKFLSLERLVVENCPKMKIFSGGELSTPSLGKIHRYRYKNSDWTWEDDLNTTIRH 181 SGNC FKF +L L V+ CP MKIFSG ELSTPSL ++ + WTW+ DLN+TI+ Sbjct: 245 SGNCAFKFPALTYLSVDKCPNMKIFSGTELSTPSLHEVEKRWLSGEYWTWKGDLNSTIQQ 304 Query: 182 LYLETMGVDKEEND 223 +YLET V ++D Sbjct: 305 IYLETKEVQNHKDD 318 >XP_006471840.1 PREDICTED: uncharacterized protein LOC102612846 [Citrus sinensis] Length = 328 Score = 84.3 bits (207), Expect = 3e-17 Identities = 39/74 (52%), Positives = 50/74 (67%) Frame = +2 Query: 2 SGNCTFKFLSLERLVVENCPKMKIFSGGELSTPSLGKIHRYRYKNSDWTWEDDLNTTIRH 181 SGNC FKF +L L V+ CP MKIFSG ELSTPSL ++ + WTW+ DLN+TI+ Sbjct: 245 SGNCAFKFPALTYLSVDKCPNMKIFSGTELSTPSLHEVEKRWLSGEYWTWKGDLNSTIQQ 304 Query: 182 LYLETMGVDKEEND 223 +YLET V ++D Sbjct: 305 IYLETKEVQNHKDD 318 >KDO38849.1 hypothetical protein CISIN_1g037562mg [Citrus sinensis] Length = 670 Score = 84.7 bits (208), Expect = 5e-17 Identities = 41/68 (60%), Positives = 49/68 (72%), Gaps = 1/68 (1%) Frame = +2 Query: 2 SGNCTFKFLSLERLVVENCPKMKIFSGGELSTPSLGKIHRYRYKNSD-WTWEDDLNTTIR 178 SGNC F F SLE LVV CP MKIFSGGELSTP+L K+ R+ + W W DLNTTI+ Sbjct: 147 SGNCAFTFPSLEILVVNYCPNMKIFSGGELSTPNLHKVQLSRWDGEEHWIWVHDLNTTIK 206 Query: 179 HLYLETMG 202 +LYL+ +G Sbjct: 207 YLYLKKLG 214 >XP_015383917.1 PREDICTED: probable disease resistance protein At4g27220 [Citrus sinensis] Length = 1001 Score = 84.3 bits (207), Expect = 7e-17 Identities = 39/61 (63%), Positives = 48/61 (78%), Gaps = 1/61 (1%) Frame = +2 Query: 8 NCTFKFLSLERLVVENCPKMKIFSGGELSTPSLGKIHRYRYKNSD-WTWEDDLNTTIRHL 184 NC FKF SLERLVVE+CP M IFSGGELSTP+L K+ ++ + W W+DDLNTTI++L Sbjct: 925 NCAFKFPSLERLVVEDCPNMSIFSGGELSTPNLRKVQLKQWDDEKRWAWKDDLNTTIQYL 984 Query: 185 Y 187 Y Sbjct: 985 Y 985 >XP_015383916.1 PREDICTED: probable disease resistance protein At4g27220 isoform X2 [Citrus sinensis] Length = 1074 Score = 84.3 bits (207), Expect = 7e-17 Identities = 39/74 (52%), Positives = 50/74 (67%) Frame = +2 Query: 2 SGNCTFKFLSLERLVVENCPKMKIFSGGELSTPSLGKIHRYRYKNSDWTWEDDLNTTIRH 181 SGNC FKF +L L V+ CP MKIFSG ELSTPSL ++ + WTW+ DLN+TI+ Sbjct: 991 SGNCAFKFPALTYLSVDKCPNMKIFSGTELSTPSLHEVEKRWLSGEYWTWKGDLNSTIQQ 1050 Query: 182 LYLETMGVDKEEND 223 +YLET V ++D Sbjct: 1051 IYLETKEVQNHKDD 1064 >XP_006471896.1 PREDICTED: probable disease resistance protein At4g27220 [Citrus sinensis] Length = 1222 Score = 84.3 bits (207), Expect = 7e-17 Identities = 43/74 (58%), Positives = 54/74 (72%), Gaps = 1/74 (1%) Frame = +2 Query: 8 NCTFKFLSLERLVVENCPKMKIFSGGELSTPSLGKIHRYRYKNSD-WTWEDDLNTTIRHL 184 NC FKF SLERLVV+NCP M IFSGGELSTP L ++ R+ + + WT + DLNTTI++L Sbjct: 1151 NCAFKFPSLERLVVDNCPNMNIFSGGELSTPKLHQVQLKRWDDEECWTLDRDLNTTIQYL 1210 Query: 185 YLETMGVDKEENDK 226 YL+ KEE +K Sbjct: 1211 YLK----KKEEKEK 1220 >XP_015383915.1 PREDICTED: probable disease resistance protein At4g27220 isoform X1 [Citrus sinensis] Length = 1248 Score = 84.3 bits (207), Expect = 7e-17 Identities = 39/74 (52%), Positives = 50/74 (67%) Frame = +2 Query: 2 SGNCTFKFLSLERLVVENCPKMKIFSGGELSTPSLGKIHRYRYKNSDWTWEDDLNTTIRH 181 SGNC FKF +L L V+ CP MKIFSG ELSTPSL ++ + WTW+ DLN+TI+ Sbjct: 1165 SGNCAFKFPALTYLSVDKCPNMKIFSGTELSTPSLHEVEKRWLSGEYWTWKGDLNSTIQQ 1224 Query: 182 LYLETMGVDKEEND 223 +YLET V ++D Sbjct: 1225 IYLETKEVQNHKDD 1238 >KDO38254.1 hypothetical protein CISIN_1g0385762mg, partial [Citrus sinensis] Length = 214 Score = 79.7 bits (195), Expect = 3e-16 Identities = 37/62 (59%), Positives = 43/62 (69%) Frame = +2 Query: 8 NCTFKFLSLERLVVENCPKMKIFSGGELSTPSLGKIHRYRYKNSDWTWEDDLNTTIRHLY 187 NC FKF SLERLVV CP MKIFS GELSTP L K+ W W+ DLNTTI+++Y Sbjct: 150 NCAFKFPSLERLVVNRCPNMKIFSEGELSTPKLQKVQMSLVDEKLWAWDRDLNTTIQYVY 209 Query: 188 LE 193 L+ Sbjct: 210 LK 211 >CAN62856.1 hypothetical protein VITISV_013426 [Vitis vinifera] Length = 186 Score = 79.0 bits (193), Expect = 3e-16 Identities = 37/68 (54%), Positives = 48/68 (70%) Frame = +2 Query: 2 SGNCTFKFLSLERLVVENCPKMKIFSGGELSTPSLGKIHRYRYKNSDWTWEDDLNTTIRH 181 SG CTF F SL+ LVVE CPKMK+FS G +TP ++ R N++W WEDDLNTTI+ Sbjct: 88 SGGCTFTFPSLDHLVVEECPKMKVFSQGFSTTP---RLERVDVANNEWHWEDDLNTTIQK 144 Query: 182 LYLETMGV 205 L+++ GV Sbjct: 145 LFIQLHGV 152