BLASTX nr result
ID: Phellodendron21_contig00034803
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00034803 (359 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006422794.1 hypothetical protein CICLE_v10029096mg [Citrus cl... 54 4e-06 >XP_006422794.1 hypothetical protein CICLE_v10029096mg [Citrus clementina] ESR36034.1 hypothetical protein CICLE_v10029096mg [Citrus clementina] Length = 259 Score = 53.9 bits (128), Expect = 4e-06 Identities = 30/66 (45%), Positives = 38/66 (57%), Gaps = 1/66 (1%) Frame = -2 Query: 271 RPSIAERIRGNXXXXXXXXXXXXXXXXXSGLLHGIKKVLIIRRN-GQNMGNAGNKVIFIT 95 +PS+ ER RGN LH KKVL++RRN GQ+ GN+G+K+I IT Sbjct: 196 KPSLVERFRGNASSPAASSASSPSPS---SFLHKTKKVLVVRRNSGQDRGNSGDKIIIIT 252 Query: 94 RKPAMK 77 RKP MK Sbjct: 253 RKPPMK 258