BLASTX nr result
ID: Phellodendron21_contig00034741
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00034741 (411 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006492887.1 PREDICTED: G patch domain-containing protein 11 [... 70 6e-12 XP_006429834.1 hypothetical protein CICLE_v10012490mg [Citrus cl... 70 6e-12 XP_010524390.1 PREDICTED: G patch domain-containing protein 11 [... 69 3e-11 XP_004250923.1 PREDICTED: G patch domain-containing protein 11 [... 67 1e-10 XP_015057016.1 PREDICTED: G patch domain-containing protein 11 [... 67 1e-10 XP_017244557.1 PREDICTED: G patch domain-containing protein 11 [... 67 1e-10 XP_016548401.1 PREDICTED: G patch domain-containing protein 11 i... 66 2e-10 XP_006365199.1 PREDICTED: G patch domain-containing protein 11 [... 66 3e-10 GAV63936.1 G-patch domain-containing protein/DUF4187 domain-cont... 65 8e-10 XP_019243035.1 PREDICTED: G patch domain-containing protein 11 i... 64 1e-09 XP_016498963.1 PREDICTED: G patch domain-containing protein 11-l... 64 1e-09 XP_009791986.1 PREDICTED: G patch domain-containing protein 11 [... 64 1e-09 XP_019243033.1 PREDICTED: G patch domain-containing protein 11 i... 64 1e-09 XP_012087742.1 PREDICTED: G patch domain-containing protein 11 [... 64 1e-09 XP_002323290.2 hypothetical protein POPTR_0016s04900g [Populus t... 64 2e-09 OIT04331.1 hypothetical protein A4A49_08076, partial [Nicotiana ... 64 2e-09 XP_016498371.1 PREDICTED: G patch domain-containing protein 11-l... 64 2e-09 OMO55197.1 hypothetical protein COLO4_36138 [Corchorus olitorius] 63 2e-09 XP_009612110.2 PREDICTED: G patch domain-containing protein 11 [... 64 2e-09 OAY43133.1 hypothetical protein MANES_08G045100 [Manihot esculenta] 64 2e-09 >XP_006492887.1 PREDICTED: G patch domain-containing protein 11 [Citrus sinensis] KDO50161.1 hypothetical protein CISIN_1g024657mg [Citrus sinensis] KDO50162.1 hypothetical protein CISIN_1g024657mg [Citrus sinensis] Length = 264 Score = 70.5 bits (171), Expect = 6e-12 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +1 Query: 52 KLRDGYHYCLFCGFQYESAETLSSNCPGIDEDDH 153 KLRD +HYCLFCG QYES+E LSSNCPGIDEDDH Sbjct: 231 KLRDEFHYCLFCGVQYESSEALSSNCPGIDEDDH 264 >XP_006429834.1 hypothetical protein CICLE_v10012490mg [Citrus clementina] XP_006429835.1 hypothetical protein CICLE_v10012490mg [Citrus clementina] ESR43074.1 hypothetical protein CICLE_v10012490mg [Citrus clementina] ESR43075.1 hypothetical protein CICLE_v10012490mg [Citrus clementina] Length = 264 Score = 70.5 bits (171), Expect = 6e-12 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +1 Query: 52 KLRDGYHYCLFCGFQYESAETLSSNCPGIDEDDH 153 KLRD +HYCLFCG QYES+E LSSNCPGIDEDDH Sbjct: 231 KLRDEFHYCLFCGVQYESSEALSSNCPGIDEDDH 264 >XP_010524390.1 PREDICTED: G patch domain-containing protein 11 [Tarenaya hassleriana] Length = 266 Score = 68.6 bits (166), Expect = 3e-11 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 52 KLRDGYHYCLFCGFQYESAETLSSNCPGIDEDDH 153 KLRD Y YCLFCGFQYE+AE L+SNCPGI+EDDH Sbjct: 233 KLRDEYRYCLFCGFQYETAEALASNCPGINEDDH 266 >XP_004250923.1 PREDICTED: G patch domain-containing protein 11 [Solanum lycopersicum] Length = 244 Score = 67.0 bits (162), Expect = 1e-10 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = +1 Query: 52 KLRDGYHYCLFCGFQYESAETLSSNCPGIDEDDH 153 KLRD YHYCLFCG QYES E L SNCPGI EDDH Sbjct: 211 KLRDEYHYCLFCGCQYESTEALQSNCPGITEDDH 244 >XP_015057016.1 PREDICTED: G patch domain-containing protein 11 [Solanum pennellii] Length = 248 Score = 67.0 bits (162), Expect = 1e-10 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = +1 Query: 52 KLRDGYHYCLFCGFQYESAETLSSNCPGIDEDDH 153 KLRD YHYCLFCG QYES E L SNCPGI EDDH Sbjct: 215 KLRDEYHYCLFCGCQYESTEALQSNCPGITEDDH 248 >XP_017244557.1 PREDICTED: G patch domain-containing protein 11 [Daucus carota subsp. sativus] KZM99081.1 hypothetical protein DCAR_013557 [Daucus carota subsp. sativus] Length = 250 Score = 67.0 bits (162), Expect = 1e-10 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +1 Query: 52 KLRDGYHYCLFCGFQYESAETLSSNCPGIDEDDH 153 KLRD + YCLFCG+QYES E L+SNCPGIDEDDH Sbjct: 217 KLRDEFRYCLFCGYQYESMEALNSNCPGIDEDDH 250 >XP_016548401.1 PREDICTED: G patch domain-containing protein 11 isoform X2 [Capsicum annuum] Length = 250 Score = 66.2 bits (160), Expect = 2e-10 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 52 KLRDGYHYCLFCGFQYESAETLSSNCPGIDEDDH 153 KLRDGYHYCLFCG QYES + L SNCPGI E+DH Sbjct: 217 KLRDGYHYCLFCGCQYESTKALLSNCPGITEEDH 250 >XP_006365199.1 PREDICTED: G patch domain-containing protein 11 [Solanum tuberosum] Length = 244 Score = 65.9 bits (159), Expect = 3e-10 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +1 Query: 52 KLRDGYHYCLFCGFQYESAETLSSNCPGIDEDDH 153 +LRD YHYCLFCG QYES E L SNCPGI EDDH Sbjct: 211 RLRDEYHYCLFCGCQYESTEALQSNCPGITEDDH 244 >GAV63936.1 G-patch domain-containing protein/DUF4187 domain-containing protein [Cephalotus follicularis] Length = 263 Score = 64.7 bits (156), Expect = 8e-10 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +1 Query: 52 KLRDGYHYCLFCGFQYESAETLSSNCPGIDEDDH 153 KLRD Y YCLFCGFQYES E L SNCPG +EDDH Sbjct: 230 KLRDEYQYCLFCGFQYESMEALLSNCPGTNEDDH 263 >XP_019243035.1 PREDICTED: G patch domain-containing protein 11 isoform X2 [Nicotiana attenuata] Length = 245 Score = 63.9 bits (154), Expect = 1e-09 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 52 KLRDGYHYCLFCGFQYESAETLSSNCPGIDEDDH 153 KLRD YHYCLFCG QYES E L SNCPG+ E+DH Sbjct: 212 KLRDEYHYCLFCGCQYESTEALLSNCPGVAEEDH 245 >XP_016498963.1 PREDICTED: G patch domain-containing protein 11-like [Nicotiana tabacum] Length = 249 Score = 63.9 bits (154), Expect = 1e-09 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 52 KLRDGYHYCLFCGFQYESAETLSSNCPGIDEDDH 153 KLRD YHYCLFCG QYES E L SNCPG+ E+DH Sbjct: 216 KLRDEYHYCLFCGCQYESTEALLSNCPGVAEEDH 249 >XP_009791986.1 PREDICTED: G patch domain-containing protein 11 [Nicotiana sylvestris] Length = 249 Score = 63.9 bits (154), Expect = 1e-09 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 52 KLRDGYHYCLFCGFQYESAETLSSNCPGIDEDDH 153 KLRD YHYCLFCG QYES E L SNCPG+ E+DH Sbjct: 216 KLRDEYHYCLFCGCQYESTEALLSNCPGVAEEDH 249 >XP_019243033.1 PREDICTED: G patch domain-containing protein 11 isoform X1 [Nicotiana attenuata] Length = 253 Score = 63.9 bits (154), Expect = 1e-09 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 52 KLRDGYHYCLFCGFQYESAETLSSNCPGIDEDDH 153 KLRD YHYCLFCG QYES E L SNCPG+ E+DH Sbjct: 220 KLRDEYHYCLFCGCQYESTEALLSNCPGVAEEDH 253 >XP_012087742.1 PREDICTED: G patch domain-containing protein 11 [Jatropha curcas] KDP24602.1 hypothetical protein JCGZ_25518 [Jatropha curcas] Length = 253 Score = 63.9 bits (154), Expect = 1e-09 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +1 Query: 55 LRDGYHYCLFCGFQYESAETLSSNCPGIDEDDH 153 LRD Y YCLFCGFQYE+ E L SNCPGIDED+H Sbjct: 221 LRDEYRYCLFCGFQYETMEALLSNCPGIDEDEH 253 >XP_002323290.2 hypothetical protein POPTR_0016s04900g [Populus trichocarpa] EEF05051.2 hypothetical protein POPTR_0016s04900g [Populus trichocarpa] Length = 266 Score = 63.9 bits (154), Expect = 2e-09 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 52 KLRDGYHYCLFCGFQYESAETLSSNCPGIDEDDH 153 KLRD Y YC FCGFQYE+ E L SNCPGI+EDDH Sbjct: 233 KLRDEYQYCPFCGFQYETVEALQSNCPGINEDDH 266 >OIT04331.1 hypothetical protein A4A49_08076, partial [Nicotiana attenuata] Length = 269 Score = 63.9 bits (154), Expect = 2e-09 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 52 KLRDGYHYCLFCGFQYESAETLSSNCPGIDEDDH 153 KLRD YHYCLFCG QYES E L SNCPG+ E+DH Sbjct: 236 KLRDEYHYCLFCGCQYESTEALLSNCPGVAEEDH 269 >XP_016498371.1 PREDICTED: G patch domain-containing protein 11-like [Nicotiana tabacum] Length = 282 Score = 63.9 bits (154), Expect = 2e-09 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 52 KLRDGYHYCLFCGFQYESAETLSSNCPGIDEDDH 153 KLRD YHYCLFCG QYES E L SNCPG+ E+DH Sbjct: 249 KLRDEYHYCLFCGCQYESTEALLSNCPGVAEEDH 282 >OMO55197.1 hypothetical protein COLO4_36138 [Corchorus olitorius] Length = 216 Score = 63.2 bits (152), Expect = 2e-09 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 52 KLRDGYHYCLFCGFQYESAETLSSNCPGIDEDDH 153 KLRD YHYC FCGFQYES E L S+CPG +EDDH Sbjct: 183 KLRDEYHYCPFCGFQYESMEALLSSCPGTNEDDH 216 >XP_009612110.2 PREDICTED: G patch domain-containing protein 11 [Nicotiana tomentosiformis] Length = 284 Score = 63.9 bits (154), Expect = 2e-09 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 52 KLRDGYHYCLFCGFQYESAETLSSNCPGIDEDDH 153 KLRD YHYCLFCG QYES E L SNCPG+ E+DH Sbjct: 251 KLRDEYHYCLFCGCQYESTEALLSNCPGVAEEDH 284 >OAY43133.1 hypothetical protein MANES_08G045100 [Manihot esculenta] Length = 265 Score = 63.5 bits (153), Expect = 2e-09 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 52 KLRDGYHYCLFCGFQYESAETLSSNCPGIDEDDH 153 KLRD + YCLFCGFQYE+ E L SNCPG DEDDH Sbjct: 232 KLRDEHRYCLFCGFQYETMEALLSNCPGTDEDDH 265