BLASTX nr result
ID: Phellodendron21_contig00034721
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00034721 (374 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006434108.1 hypothetical protein CICLE_v10001827mg [Citrus cl... 74 4e-13 XP_006472704.1 PREDICTED: uncharacterized protein LOC102609948 [... 73 1e-12 OAY58218.1 hypothetical protein MANES_02G159000 [Manihot esculenta] 58 2e-07 XP_002513831.1 PREDICTED: uncharacterized protein LOC8274144 [Ri... 58 2e-07 XP_006383479.1 hypothetical protein POPTR_0005s16190g [Populus t... 56 8e-07 XP_012078156.1 PREDICTED: uncharacterized protein LOC105638878 [... 54 8e-06 >XP_006434108.1 hypothetical protein CICLE_v10001827mg [Citrus clementina] XP_006434109.1 hypothetical protein CICLE_v10001827mg [Citrus clementina] XP_006434110.1 hypothetical protein CICLE_v10001827mg [Citrus clementina] ESR47348.1 hypothetical protein CICLE_v10001827mg [Citrus clementina] ESR47349.1 hypothetical protein CICLE_v10001827mg [Citrus clementina] ESR47350.1 hypothetical protein CICLE_v10001827mg [Citrus clementina] Length = 326 Score = 73.9 bits (180), Expect = 4e-13 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = -2 Query: 145 MAKVNKVRCKSNSQRHRVAPYPLRSRSTKAGKKGLSNKKNWKALEKKD 2 MAKVNKVRCKS+S+RHRVAPYPL S KAGK+GLS KK+ + LEKKD Sbjct: 1 MAKVNKVRCKSDSRRHRVAPYPLPSGPKKAGKEGLSKKKHPRGLEKKD 48 >XP_006472704.1 PREDICTED: uncharacterized protein LOC102609948 [Citrus sinensis] XP_006472705.1 PREDICTED: uncharacterized protein LOC102609948 [Citrus sinensis] XP_006472706.1 PREDICTED: uncharacterized protein LOC102609948 [Citrus sinensis] XP_006472707.1 PREDICTED: uncharacterized protein LOC102609948 [Citrus sinensis] KDO80792.1 hypothetical protein CISIN_1g020440mg [Citrus sinensis] KDO80793.1 hypothetical protein CISIN_1g020440mg [Citrus sinensis] Length = 326 Score = 72.8 bits (177), Expect = 1e-12 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -2 Query: 145 MAKVNKVRCKSNSQRHRVAPYPLRSRSTKAGKKGLSNKKNWKALEKKD 2 MAKVNKVRCKS+S+RHR+APYPL S KAGK+GLS KK+ + LEKKD Sbjct: 1 MAKVNKVRCKSDSRRHRMAPYPLPSGPKKAGKEGLSKKKHPRGLEKKD 48 >OAY58218.1 hypothetical protein MANES_02G159000 [Manihot esculenta] Length = 326 Score = 58.2 bits (139), Expect = 2e-07 Identities = 28/48 (58%), Positives = 35/48 (72%) Frame = -2 Query: 145 MAKVNKVRCKSNSQRHRVAPYPLRSRSTKAGKKGLSNKKNWKALEKKD 2 M KV+KV+CK++SQRHRV PYPL + K+ K S KK+ KALEK D Sbjct: 1 MGKVDKVKCKADSQRHRVTPYPLPASRRKSSKDCHSKKKHSKALEKND 48 >XP_002513831.1 PREDICTED: uncharacterized protein LOC8274144 [Ricinus communis] XP_015571578.1 PREDICTED: uncharacterized protein LOC8274144 [Ricinus communis] EEF48414.1 conserved hypothetical protein [Ricinus communis] Length = 327 Score = 58.2 bits (139), Expect = 2e-07 Identities = 27/48 (56%), Positives = 34/48 (70%) Frame = -2 Query: 145 MAKVNKVRCKSNSQRHRVAPYPLRSRSTKAGKKGLSNKKNWKALEKKD 2 MAK NKV+CK++S+RHR+ PYPL K+ K S KK+ KALEK D Sbjct: 1 MAKANKVKCKADSRRHRMTPYPLPPCQRKSAKGSCSKKKHLKALEKND 48 >XP_006383479.1 hypothetical protein POPTR_0005s16190g [Populus trichocarpa] ERP61276.1 hypothetical protein POPTR_0005s16190g [Populus trichocarpa] Length = 315 Score = 56.2 bits (134), Expect = 8e-07 Identities = 30/48 (62%), Positives = 34/48 (70%) Frame = -2 Query: 145 MAKVNKVRCKSNSQRHRVAPYPLRSRSTKAGKKGLSNKKNWKALEKKD 2 MAKVNKVRCK++S+R RV PY L S KAGK KK+ KA EKKD Sbjct: 1 MAKVNKVRCKADSRRQRVMPYVLSPCSRKAGKDCHLKKKHLKASEKKD 48 >XP_012078156.1 PREDICTED: uncharacterized protein LOC105638878 [Jatropha curcas] KDP32743.1 hypothetical protein JCGZ_12035 [Jatropha curcas] Length = 328 Score = 53.5 bits (127), Expect = 8e-06 Identities = 28/48 (58%), Positives = 33/48 (68%) Frame = -2 Query: 145 MAKVNKVRCKSNSQRHRVAPYPLRSRSTKAGKKGLSNKKNWKALEKKD 2 MAKV+KV+ K+ SQ HR+ PYPL SR K K S KK+ KALEK D Sbjct: 1 MAKVSKVKGKAGSQHHRMTPYPLPSRPRKNSKGCHSKKKHSKALEKND 48