BLASTX nr result
ID: Phellodendron21_contig00034473
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00034473 (330 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006465441.1 PREDICTED: E3 ubiquitin-protein ligase At1g63170 ... 75 2e-13 XP_006427099.1 hypothetical protein CICLE_v10025899mg [Citrus cl... 75 2e-13 >XP_006465441.1 PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X2 [Citrus sinensis] XP_006465442.1 PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X2 [Citrus sinensis] Length = 423 Score = 74.7 bits (182), Expect = 2e-13 Identities = 37/46 (80%), Positives = 39/46 (84%) Frame = +1 Query: 193 MDVHSLGLIRDTETDQYPLLMEQMHHRNDCEDIIGITTTDDASSSS 330 MDV SLGLIRDTETDQYPLLMEQ+H D + II ITTTDDASSSS Sbjct: 1 MDVRSLGLIRDTETDQYPLLMEQVHRHTDRDHIIDITTTDDASSSS 46 >XP_006427099.1 hypothetical protein CICLE_v10025899mg [Citrus clementina] XP_006427100.1 hypothetical protein CICLE_v10025899mg [Citrus clementina] XP_006427102.1 hypothetical protein CICLE_v10025899mg [Citrus clementina] ESR40339.1 hypothetical protein CICLE_v10025899mg [Citrus clementina] ESR40340.1 hypothetical protein CICLE_v10025899mg [Citrus clementina] ESR40342.1 hypothetical protein CICLE_v10025899mg [Citrus clementina] KDO58186.1 hypothetical protein CISIN_1g037568mg [Citrus sinensis] Length = 423 Score = 74.7 bits (182), Expect = 2e-13 Identities = 37/46 (80%), Positives = 39/46 (84%) Frame = +1 Query: 193 MDVHSLGLIRDTETDQYPLLMEQMHHRNDCEDIIGITTTDDASSSS 330 MDV SLGLIRDTETDQYPLLMEQ+H D + II ITTTDDASSSS Sbjct: 1 MDVRSLGLIRDTETDQYPLLMEQVHRHTDRDHIIDITTTDDASSSS 46