BLASTX nr result
ID: Phellodendron21_contig00034469
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00034469 (709 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006440721.1 hypothetical protein CICLE_v10020839mg [Citrus cl... 77 7e-13 XP_006477643.2 PREDICTED: uncharacterized protein LOC102617962 i... 76 1e-12 GAV85278.1 hypothetical protein CFOL_v3_28716 [Cephalotus follic... 72 2e-11 XP_010663273.1 PREDICTED: uncharacterized protein LOC100262180 i... 69 1e-10 XP_015571938.1 PREDICTED: uncharacterized protein LOC8284444 iso... 69 2e-10 XP_002514669.1 PREDICTED: uncharacterized protein LOC8284444 iso... 69 2e-10 XP_010663272.1 PREDICTED: uncharacterized protein LOC100262180 i... 69 2e-10 XP_010663271.1 PREDICTED: uncharacterized protein LOC100262180 i... 69 2e-10 XP_010663270.1 PREDICTED: uncharacterized protein LOC100262180 i... 69 3e-10 XP_019082130.1 PREDICTED: uncharacterized protein LOC100251942 i... 68 4e-10 XP_010663268.1 PREDICTED: uncharacterized protein LOC100251942 i... 68 7e-10 XP_019082129.1 PREDICTED: uncharacterized protein LOC100251942 i... 68 7e-10 XP_010663267.1 PREDICTED: uncharacterized protein LOC100251942 i... 68 8e-10 XP_010663265.1 PREDICTED: uncharacterized protein LOC100251942 i... 68 9e-10 OAY47533.1 hypothetical protein MANES_06G086000 [Manihot esculen... 67 1e-09 XP_015571937.1 PREDICTED: uncharacterized protein LOC8284444 iso... 67 1e-09 XP_015571936.1 PREDICTED: uncharacterized protein LOC8284444 iso... 67 2e-09 EOY22036.1 Uncharacterized protein TCM_014214 isoform 1 [Theobro... 67 2e-09 XP_012080564.1 PREDICTED: LOW QUALITY PROTEIN: uncharacterized p... 67 2e-09 KDP31329.1 hypothetical protein JCGZ_11705 [Jatropha curcas] 67 2e-09 >XP_006440721.1 hypothetical protein CICLE_v10020839mg [Citrus clementina] XP_006440722.1 hypothetical protein CICLE_v10020839mg [Citrus clementina] ESR53961.1 hypothetical protein CICLE_v10020839mg [Citrus clementina] ESR53962.1 hypothetical protein CICLE_v10020839mg [Citrus clementina] Length = 355 Score = 77.0 bits (188), Expect = 7e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -2 Query: 708 QEILQVYLTTWLAEVNIDTHRVNEIFTAIGEEMHVSIS 595 QEILQVYLTTWLAEVN+DTHRVNEIFT IGEEMHVSIS Sbjct: 318 QEILQVYLTTWLAEVNVDTHRVNEIFTTIGEEMHVSIS 355 >XP_006477643.2 PREDICTED: uncharacterized protein LOC102617962 isoform X1 [Citrus sinensis] Length = 310 Score = 75.9 bits (185), Expect = 1e-12 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -2 Query: 708 QEILQVYLTTWLAEVNIDTHRVNEIFTAIGEEMHVSIS 595 QEILQVYLTTWLAEVN+DTHRVNEIFT IGEEMHV+IS Sbjct: 273 QEILQVYLTTWLAEVNVDTHRVNEIFTTIGEEMHVNIS 310 >GAV85278.1 hypothetical protein CFOL_v3_28716 [Cephalotus follicularis] Length = 294 Score = 72.4 bits (176), Expect = 2e-11 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -2 Query: 705 EILQVYLTTWLAEVNIDTHRVNEIFTAIGEEMHVSIS 595 EILQVYLTTWLAEVNIDTHR+NEIFT IGEEMHV++S Sbjct: 258 EILQVYLTTWLAEVNIDTHRLNEIFTVIGEEMHVALS 294 >XP_010663273.1 PREDICTED: uncharacterized protein LOC100262180 isoform X5 [Vitis vinifera] Length = 223 Score = 69.3 bits (168), Expect = 1e-10 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -2 Query: 705 EILQVYLTTWLAEVNIDTHRVNEIFTAIGEEMHVSIS 595 EILQVYLTTWLAEVNIDTHRV+EIF IGEEMHV +S Sbjct: 187 EILQVYLTTWLAEVNIDTHRVDEIFAVIGEEMHVGLS 223 >XP_015571938.1 PREDICTED: uncharacterized protein LOC8284444 isoform X4 [Ricinus communis] Length = 268 Score = 69.3 bits (168), Expect = 2e-10 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -2 Query: 708 QEILQVYLTTWLAEVNIDTHRVNEIFTAIGEEMHVSIS 595 +E+LQVYLTTWLAEVNIDTHRV+EIF IG+EMHVS+S Sbjct: 231 REVLQVYLTTWLAEVNIDTHRVDEIFAIIGDEMHVSLS 268 >XP_002514669.1 PREDICTED: uncharacterized protein LOC8284444 isoform X2 [Ricinus communis] EEF47775.1 conserved hypothetical protein [Ricinus communis] Length = 285 Score = 69.3 bits (168), Expect = 2e-10 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -2 Query: 708 QEILQVYLTTWLAEVNIDTHRVNEIFTAIGEEMHVSIS 595 +E+LQVYLTTWLAEVNIDTHRV+EIF IG+EMHVS+S Sbjct: 248 REVLQVYLTTWLAEVNIDTHRVDEIFAIIGDEMHVSLS 285 >XP_010663272.1 PREDICTED: uncharacterized protein LOC100262180 isoform X3 [Vitis vinifera] Length = 289 Score = 69.3 bits (168), Expect = 2e-10 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -2 Query: 705 EILQVYLTTWLAEVNIDTHRVNEIFTAIGEEMHVSIS 595 EILQVYLTTWLAEVNIDTHRV+EIF IGEEMHV +S Sbjct: 253 EILQVYLTTWLAEVNIDTHRVDEIFAVIGEEMHVGLS 289 >XP_010663271.1 PREDICTED: uncharacterized protein LOC100262180 isoform X2 [Vitis vinifera] Length = 297 Score = 69.3 bits (168), Expect = 2e-10 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -2 Query: 705 EILQVYLTTWLAEVNIDTHRVNEIFTAIGEEMHVSIS 595 EILQVYLTTWLAEVNIDTHRV+EIF IGEEMHV +S Sbjct: 261 EILQVYLTTWLAEVNIDTHRVDEIFAVIGEEMHVGLS 297 >XP_010663270.1 PREDICTED: uncharacterized protein LOC100262180 isoform X1 [Vitis vinifera] CBI15137.3 unnamed protein product, partial [Vitis vinifera] Length = 303 Score = 69.3 bits (168), Expect = 3e-10 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -2 Query: 705 EILQVYLTTWLAEVNIDTHRVNEIFTAIGEEMHVSIS 595 EILQVYLTTWLAEVNIDTHRV+EIF IGEEMHV +S Sbjct: 267 EILQVYLTTWLAEVNIDTHRVDEIFAVIGEEMHVGLS 303 >XP_019082130.1 PREDICTED: uncharacterized protein LOC100251942 isoform X6 [Vitis vinifera] Length = 223 Score = 67.8 bits (164), Expect = 4e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -2 Query: 705 EILQVYLTTWLAEVNIDTHRVNEIFTAIGEEMHVSI 598 EILQVYLTTWLAEVNIDTHRV+EIF IGEEMHV + Sbjct: 187 EILQVYLTTWLAEVNIDTHRVDEIFAVIGEEMHVGL 222 >XP_010663268.1 PREDICTED: uncharacterized protein LOC100251942 isoform X4 [Vitis vinifera] Length = 270 Score = 67.8 bits (164), Expect = 7e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -2 Query: 705 EILQVYLTTWLAEVNIDTHRVNEIFTAIGEEMHVSI 598 EILQVYLTTWLAEVNIDTHRV+EIF IGEEMHV + Sbjct: 234 EILQVYLTTWLAEVNIDTHRVDEIFAVIGEEMHVGL 269 >XP_019082129.1 PREDICTED: uncharacterized protein LOC100251942 isoform X3 [Vitis vinifera] Length = 271 Score = 67.8 bits (164), Expect = 7e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -2 Query: 705 EILQVYLTTWLAEVNIDTHRVNEIFTAIGEEMHVSI 598 EILQVYLTTWLAEVNIDTHRV+EIF IGEEMHV + Sbjct: 235 EILQVYLTTWLAEVNIDTHRVDEIFAVIGEEMHVGL 270 >XP_010663267.1 PREDICTED: uncharacterized protein LOC100251942 isoform X2 [Vitis vinifera] Length = 289 Score = 67.8 bits (164), Expect = 8e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -2 Query: 705 EILQVYLTTWLAEVNIDTHRVNEIFTAIGEEMHVSI 598 EILQVYLTTWLAEVNIDTHRV+EIF IGEEMHV + Sbjct: 253 EILQVYLTTWLAEVNIDTHRVDEIFAVIGEEMHVGL 288 >XP_010663265.1 PREDICTED: uncharacterized protein LOC100251942 isoform X1 [Vitis vinifera] CBI15138.3 unnamed protein product, partial [Vitis vinifera] Length = 303 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -2 Query: 705 EILQVYLTTWLAEVNIDTHRVNEIFTAIGEEMHVSI 598 EILQVYLTTWLAEVNIDTHRV+EIF IGEEMHV + Sbjct: 267 EILQVYLTTWLAEVNIDTHRVDEIFAVIGEEMHVGL 302 >OAY47533.1 hypothetical protein MANES_06G086000 [Manihot esculenta] OAY47534.1 hypothetical protein MANES_06G086000 [Manihot esculenta] OAY47535.1 hypothetical protein MANES_06G086000 [Manihot esculenta] Length = 296 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -2 Query: 708 QEILQVYLTTWLAEVNIDTHRVNEIFTAIGEEMHVSIS 595 Q+ILQVYLTTWLAEVN+D HRV+EIF IGEEMHV++S Sbjct: 259 QDILQVYLTTWLAEVNVDIHRVDEIFAIIGEEMHVNLS 296 >XP_015571937.1 PREDICTED: uncharacterized protein LOC8284444 isoform X3 [Ricinus communis] Length = 273 Score = 67.0 bits (162), Expect = 1e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -2 Query: 702 ILQVYLTTWLAEVNIDTHRVNEIFTAIGEEMHVSIS 595 +LQVYLTTWLAEVNIDTHRV+EIF IG+EMHVS+S Sbjct: 238 VLQVYLTTWLAEVNIDTHRVDEIFAIIGDEMHVSLS 273 >XP_015571936.1 PREDICTED: uncharacterized protein LOC8284444 isoform X1 [Ricinus communis] Length = 290 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -2 Query: 702 ILQVYLTTWLAEVNIDTHRVNEIFTAIGEEMHVSIS 595 +LQVYLTTWLAEVNIDTHRV+EIF IG+EMHVS+S Sbjct: 255 VLQVYLTTWLAEVNIDTHRVDEIFAIIGDEMHVSLS 290 >EOY22036.1 Uncharacterized protein TCM_014214 isoform 1 [Theobroma cacao] Length = 292 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -2 Query: 705 EILQVYLTTWLAEVNIDTHRVNEIFTAIGEEMHVSIS 595 EILQVY+TTWLAEVNID HRV+EIF IGEEMH+S+S Sbjct: 256 EILQVYITTWLAEVNIDGHRVDEIFAVIGEEMHISLS 292 >XP_012080564.1 PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105640780 [Jatropha curcas] Length = 297 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -2 Query: 705 EILQVYLTTWLAEVNIDTHRVNEIFTAIGEEMHVSIS 595 EILQVYLTTWLAE NID HRVNEIF IGEE+HVS+S Sbjct: 261 EILQVYLTTWLAEANIDIHRVNEIFAIIGEEIHVSLS 297 >KDP31329.1 hypothetical protein JCGZ_11705 [Jatropha curcas] Length = 308 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -2 Query: 705 EILQVYLTTWLAEVNIDTHRVNEIFTAIGEEMHVSIS 595 EILQVYLTTWLAE NID HRVNEIF IGEE+HVS+S Sbjct: 272 EILQVYLTTWLAEANIDIHRVNEIFAIIGEEIHVSLS 308