BLASTX nr result
ID: Phellodendron21_contig00034405
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00034405 (307 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007414377.1 hypothetical protein MELLADRAFT_75483 [Melampsora... 55 1e-06 >XP_007414377.1 hypothetical protein MELLADRAFT_75483 [Melampsora larici-populina 98AG31] EGG02392.1 hypothetical protein MELLADRAFT_75483 [Melampsora larici-populina 98AG31] Length = 486 Score = 55.1 bits (131), Expect = 1e-06 Identities = 32/58 (55%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = -2 Query: 306 LLQRIEGVIGKKMSEFPHDKEQVMILGXXXXXXXXXXXXXXXXXXRQG-KFKRKRKNG 136 LLQRIEGVIGKKM+EF H KEQVM+LG R G KF RKRK+G Sbjct: 409 LLQRIEGVIGKKMNEFEHQKEQVMVLGERVGEAAREVAREMREIERNGNKFNRKRKSG 466