BLASTX nr result
ID: Phellodendron21_contig00034385
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00034385 (613 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007409334.1 hypothetical protein MELLADRAFT_105955 [Melampsor... 120 1e-30 XP_003322343.2 hypothetical protein PGTG_03880 [Puccinia gramini... 58 1e-06 >XP_007409334.1 hypothetical protein MELLADRAFT_105955 [Melampsora larici-populina 98AG31] EGG07427.1 hypothetical protein MELLADRAFT_105955 [Melampsora larici-populina 98AG31] Length = 193 Score = 120 bits (300), Expect = 1e-30 Identities = 56/94 (59%), Positives = 69/94 (73%) Frame = -3 Query: 440 SGTSTPIPNMNTEDLDWQRERARDVEQNKWWNWAKVCRTTGDSNESAQAAVLRCQDLEPE 261 SGTSTP+ M ED + R+R RD EQNKWW+W++ C+ TGD+N SA + V RC+DLE + Sbjct: 101 SGTSTPVLRMRAEDFELNRDRNRDAEQNKWWHWSRPCKKTGDANHSAYSPV-RCEDLEVD 159 Query: 260 PETEIVTKRAMVCHLDGEITHPIDGSKWRLKVGL 159 E IVTK A+VC LDGE THP D SKWR+K GL Sbjct: 160 DEDGIVTKCAIVCPLDGEFTHPNDKSKWRVKNGL 193 >XP_003322343.2 hypothetical protein PGTG_03880 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP77924.2 hypothetical protein PGTG_03880 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 327 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/39 (58%), Positives = 30/39 (76%) Frame = -3 Query: 383 ERARDVEQNKWWNWAKVCRTTGDSNESAQAAVLRCQDLE 267 E + EQ+KWW+WAKVC+ TGD N+S+ A LRCQDL+ Sbjct: 251 ELRKTEEQDKWWHWAKVCKVTGDGNKSSHLAPLRCQDLK 289