BLASTX nr result
ID: Phellodendron21_contig00034296
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00034296 (425 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007413498.1 hypothetical protein MELLADRAFT_90242 [Melampsora... 60 7e-08 KNE94682.1 hypothetical protein PSTG_11957 [Puccinia striiformis... 56 2e-06 >XP_007413498.1 hypothetical protein MELLADRAFT_90242 [Melampsora larici-populina 98AG31] EGG03363.1 hypothetical protein MELLADRAFT_90242 [Melampsora larici-populina 98AG31] Length = 386 Score = 60.1 bits (144), Expect = 7e-08 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = -1 Query: 140 STRLVPNGKSIPLQPIEPRILPSALTVSNSVLSCIGGTPLVRLDR 6 ST VP+ L PI+PRIL SA T+S+SVLSCIGGTPLVRLDR Sbjct: 2 STSTVPSNTLPILAPIKPRILSSASTISDSVLSCIGGTPLVRLDR 46 >KNE94682.1 hypothetical protein PSTG_11957 [Puccinia striiformis f. sp. tritici PST-78] Length = 421 Score = 55.8 bits (133), Expect = 2e-06 Identities = 29/56 (51%), Positives = 38/56 (67%) Frame = -1 Query: 170 IIMSSFSPVSSTRLVPNGKSIPLQPIEPRILPSALTVSNSVLSCIGGTPLVRLDRL 3 I+ + +P S L N ++ P++PRI S LT+S+SVLSCIG TPLVRLDRL Sbjct: 7 ILNGNSTPSSEGPLAKNQETQDQDPVKPRIDNSVLTISDSVLSCIGATPLVRLDRL 62