BLASTX nr result
ID: Phellodendron21_contig00034127
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00034127 (413 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO76346.1 hypothetical protein CISIN_1g000450mg [Citrus sinensis] 92 5e-19 KDO76344.1 hypothetical protein CISIN_1g000450mg [Citrus sinensi... 92 5e-19 XP_006439463.1 hypothetical protein CICLE_v10018484mg [Citrus cl... 92 5e-19 XP_006476488.1 PREDICTED: uncharacterized protein LOC102611872 i... 89 6e-18 XP_012086817.1 PREDICTED: uncharacterized protein LOC105645746 [... 87 2e-17 OAY56442.1 hypothetical protein MANES_02G016800 [Manihot esculenta] 86 7e-17 XP_015896487.1 PREDICTED: uncharacterized protein LOC107430195 i... 83 6e-16 XP_011463926.1 PREDICTED: uncharacterized protein LOC101292709 [... 82 1e-15 XP_002298009.2 hypothetical protein POPTR_0001s09920g [Populus t... 82 1e-15 GAV76135.1 WD40 domain-containing protein [Cephalotus follicularis] 82 2e-15 ONI07220.1 hypothetical protein PRUPE_5G106900 [Prunus persica] 82 2e-15 XP_007210916.1 hypothetical protein PRUPE_ppa000184mg [Prunus pe... 82 2e-15 XP_002304520.2 hypothetical protein POPTR_0003s13270g [Populus t... 80 5e-15 XP_011022757.1 PREDICTED: uncharacterized protein LOC105124436, ... 80 8e-15 XP_008238978.1 PREDICTED: WD repeat-containing protein 7 isoform... 80 1e-14 XP_002509865.1 PREDICTED: uncharacterized protein LOC8287440 iso... 79 2e-14 XP_010112621.1 WD repeat-containing protein 7 [Morus notabilis] ... 79 3e-14 XP_013447113.1 transducin/WD-like repeat-protein [Medicago trunc... 78 4e-14 XP_009363386.1 PREDICTED: WD repeat-containing protein 7-like [P... 78 5e-14 XP_008375960.1 PREDICTED: WD repeat-containing protein 7 [Malus ... 77 7e-14 >KDO76346.1 hypothetical protein CISIN_1g000450mg [Citrus sinensis] Length = 1313 Score = 92.0 bits (227), Expect = 5e-19 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = -3 Query: 411 SNLQENGRSLSYADSLKLLIHNLDLSYRLKWVGDRKVLLTRHGLELGTFQL 259 SNLQE+ SLSYAD+LKLLI NLDLSYRL+WVGDRKVLLTRHGLELGTFQL Sbjct: 1263 SNLQEHAGSLSYADNLKLLIQNLDLSYRLEWVGDRKVLLTRHGLELGTFQL 1313 >KDO76344.1 hypothetical protein CISIN_1g000450mg [Citrus sinensis] KDO76345.1 hypothetical protein CISIN_1g000450mg [Citrus sinensis] Length = 1496 Score = 92.0 bits (227), Expect = 5e-19 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = -3 Query: 411 SNLQENGRSLSYADSLKLLIHNLDLSYRLKWVGDRKVLLTRHGLELGTFQL 259 SNLQE+ SLSYAD+LKLLI NLDLSYRL+WVGDRKVLLTRHGLELGTFQL Sbjct: 1446 SNLQEHAGSLSYADNLKLLIQNLDLSYRLEWVGDRKVLLTRHGLELGTFQL 1496 >XP_006439463.1 hypothetical protein CICLE_v10018484mg [Citrus clementina] ESR52703.1 hypothetical protein CICLE_v10018484mg [Citrus clementina] Length = 1496 Score = 92.0 bits (227), Expect = 5e-19 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = -3 Query: 411 SNLQENGRSLSYADSLKLLIHNLDLSYRLKWVGDRKVLLTRHGLELGTFQL 259 SNLQE+ SLSYAD+LKLLI NLDLSYRL+WVGDRKVLLTRHGLELGTFQL Sbjct: 1446 SNLQEHAGSLSYADNLKLLIQNLDLSYRLEWVGDRKVLLTRHGLELGTFQL 1496 >XP_006476488.1 PREDICTED: uncharacterized protein LOC102611872 isoform X1 [Citrus sinensis] Length = 1496 Score = 89.0 bits (219), Expect = 6e-18 Identities = 44/51 (86%), Positives = 47/51 (92%) Frame = -3 Query: 411 SNLQENGRSLSYADSLKLLIHNLDLSYRLKWVGDRKVLLTRHGLELGTFQL 259 SNLQE+ SLSYAD+LKLLI NLDLSYRL+WVGDRKVLLTRHGLEL TFQL Sbjct: 1446 SNLQEHAGSLSYADNLKLLIQNLDLSYRLEWVGDRKVLLTRHGLELRTFQL 1496 >XP_012086817.1 PREDICTED: uncharacterized protein LOC105645746 [Jatropha curcas] KDP25377.1 hypothetical protein JCGZ_20533 [Jatropha curcas] Length = 1519 Score = 87.4 bits (215), Expect = 2e-17 Identities = 41/51 (80%), Positives = 47/51 (92%) Frame = -3 Query: 411 SNLQENGRSLSYADSLKLLIHNLDLSYRLKWVGDRKVLLTRHGLELGTFQL 259 +NLQEN RSL+YADSLK+LI NLDLSYRL+WVG RKVLL+RHG+ELGTF L Sbjct: 1469 TNLQENARSLNYADSLKILIQNLDLSYRLEWVGGRKVLLSRHGMELGTFPL 1519 >OAY56442.1 hypothetical protein MANES_02G016800 [Manihot esculenta] Length = 1459 Score = 85.9 bits (211), Expect = 7e-17 Identities = 41/51 (80%), Positives = 45/51 (88%) Frame = -3 Query: 411 SNLQENGRSLSYADSLKLLIHNLDLSYRLKWVGDRKVLLTRHGLELGTFQL 259 + LQ+N RS SYADSLKLLI NLDLSYRL+WVG RKVLLTRHG+ELGTF L Sbjct: 1409 NKLQDNARSASYADSLKLLIQNLDLSYRLEWVGQRKVLLTRHGMELGTFPL 1459 >XP_015896487.1 PREDICTED: uncharacterized protein LOC107430195 isoform X1 [Ziziphus jujuba] Length = 1364 Score = 83.2 bits (204), Expect = 6e-16 Identities = 39/50 (78%), Positives = 43/50 (86%) Frame = -3 Query: 408 NLQENGRSLSYADSLKLLIHNLDLSYRLKWVGDRKVLLTRHGLELGTFQL 259 N EN + S+ADSLKLL+HNLDLSYRL+WVG RKVLLTRHG ELGTFQL Sbjct: 1315 NFLENSKGSSHADSLKLLVHNLDLSYRLEWVGQRKVLLTRHGQELGTFQL 1364 >XP_011463926.1 PREDICTED: uncharacterized protein LOC101292709 [Fragaria vesca subsp. vesca] Length = 1486 Score = 82.4 bits (202), Expect = 1e-15 Identities = 38/51 (74%), Positives = 46/51 (90%) Frame = -3 Query: 411 SNLQENGRSLSYADSLKLLIHNLDLSYRLKWVGDRKVLLTRHGLELGTFQL 259 +N+QEN + LS AD+LKLLIHNL+LSY+L+WVG+RKV LTRHG ELGTFQL Sbjct: 1436 ANIQENAKGLSQADNLKLLIHNLELSYQLEWVGERKVRLTRHGHELGTFQL 1486 >XP_002298009.2 hypothetical protein POPTR_0001s09920g [Populus trichocarpa] EEE82814.2 hypothetical protein POPTR_0001s09920g [Populus trichocarpa] Length = 1500 Score = 82.4 bits (202), Expect = 1e-15 Identities = 38/51 (74%), Positives = 45/51 (88%) Frame = -3 Query: 411 SNLQENGRSLSYADSLKLLIHNLDLSYRLKWVGDRKVLLTRHGLELGTFQL 259 +NLQE R +YAD+LKLLIHNLDLSY+L+WVG+RKVLL+RHGLELG F L Sbjct: 1450 ANLQEKARDSTYADNLKLLIHNLDLSYQLQWVGERKVLLSRHGLELGAFPL 1500 >GAV76135.1 WD40 domain-containing protein [Cephalotus follicularis] Length = 1492 Score = 82.0 bits (201), Expect = 2e-15 Identities = 38/51 (74%), Positives = 44/51 (86%) Frame = -3 Query: 411 SNLQENGRSLSYADSLKLLIHNLDLSYRLKWVGDRKVLLTRHGLELGTFQL 259 +NLQEN L+YA+S KL+IHNLDLSYRL WVG+R +LLTRHG ELGTFQL Sbjct: 1442 ANLQENAGVLNYAESFKLVIHNLDLSYRLDWVGERNILLTRHGHELGTFQL 1492 >ONI07220.1 hypothetical protein PRUPE_5G106900 [Prunus persica] Length = 1393 Score = 81.6 bits (200), Expect = 2e-15 Identities = 39/50 (78%), Positives = 44/50 (88%) Frame = -3 Query: 408 NLQENGRSLSYADSLKLLIHNLDLSYRLKWVGDRKVLLTRHGLELGTFQL 259 N+QE + LS AD+LKLLIHNLDLSYRL+WVG+RKVLLTRHG ELGTF L Sbjct: 1344 NVQEGTKGLSQADNLKLLIHNLDLSYRLEWVGERKVLLTRHGHELGTFPL 1393 >XP_007210916.1 hypothetical protein PRUPE_ppa000184mg [Prunus persica] ONI07219.1 hypothetical protein PRUPE_5G106900 [Prunus persica] Length = 1506 Score = 81.6 bits (200), Expect = 2e-15 Identities = 39/50 (78%), Positives = 44/50 (88%) Frame = -3 Query: 408 NLQENGRSLSYADSLKLLIHNLDLSYRLKWVGDRKVLLTRHGLELGTFQL 259 N+QE + LS AD+LKLLIHNLDLSYRL+WVG+RKVLLTRHG ELGTF L Sbjct: 1457 NVQEGTKGLSQADNLKLLIHNLDLSYRLEWVGERKVLLTRHGHELGTFPL 1506 >XP_002304520.2 hypothetical protein POPTR_0003s13270g [Populus trichocarpa] EEE79499.2 hypothetical protein POPTR_0003s13270g [Populus trichocarpa] Length = 1360 Score = 80.5 bits (197), Expect = 5e-15 Identities = 37/50 (74%), Positives = 43/50 (86%) Frame = -3 Query: 408 NLQENGRSLSYADSLKLLIHNLDLSYRLKWVGDRKVLLTRHGLELGTFQL 259 N+QE R +YADSLK+LIHNLDLSYRL+WV +RKVLL+RHG ELGTF L Sbjct: 1311 NMQEKARDSTYADSLKMLIHNLDLSYRLQWVSERKVLLSRHGQELGTFPL 1360 >XP_011022757.1 PREDICTED: uncharacterized protein LOC105124436, partial [Populus euphratica] Length = 1470 Score = 80.1 bits (196), Expect = 8e-15 Identities = 37/50 (74%), Positives = 43/50 (86%) Frame = -3 Query: 408 NLQENGRSLSYADSLKLLIHNLDLSYRLKWVGDRKVLLTRHGLELGTFQL 259 N+QE R +YADSLK+LIHNL LSYRL+WVG+RKVLL+RHG ELGTF L Sbjct: 1421 NMQEKARDSTYADSLKMLIHNLGLSYRLQWVGERKVLLSRHGQELGTFPL 1470 >XP_008238978.1 PREDICTED: WD repeat-containing protein 7 isoform X1 [Prunus mume] Length = 1512 Score = 79.7 bits (195), Expect = 1e-14 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = -3 Query: 408 NLQENGRSLSYADSLKLLIHNLDLSYRLKWVGDRKVLLTRHGLELGTFQL 259 N+QE + LS AD+LKLLIHNLDLSYRL+WVG RKVLLTRHG +LGTF L Sbjct: 1463 NIQEGTKGLSQADNLKLLIHNLDLSYRLEWVGKRKVLLTRHGHDLGTFPL 1512 >XP_002509865.1 PREDICTED: uncharacterized protein LOC8287440 isoform X1 [Ricinus communis] EEF51252.1 hypothetical protein RCOM_1689130 [Ricinus communis] Length = 1525 Score = 79.0 bits (193), Expect = 2e-14 Identities = 35/51 (68%), Positives = 45/51 (88%) Frame = -3 Query: 411 SNLQENGRSLSYADSLKLLIHNLDLSYRLKWVGDRKVLLTRHGLELGTFQL 259 +NLQEN R ++AD+LK+++HNLDLSYRL+WV RKVLL+RHG+ELGTF L Sbjct: 1475 TNLQENTRGSNHADNLKMVVHNLDLSYRLEWVSKRKVLLSRHGMELGTFPL 1525 >XP_010112621.1 WD repeat-containing protein 7 [Morus notabilis] EXC34346.1 WD repeat-containing protein 7 [Morus notabilis] Length = 1489 Score = 78.6 bits (192), Expect = 3e-14 Identities = 37/50 (74%), Positives = 43/50 (86%) Frame = -3 Query: 408 NLQENGRSLSYADSLKLLIHNLDLSYRLKWVGDRKVLLTRHGLELGTFQL 259 N Q+N + S+ DSLKLLIHN+DLSYRL+WVGDRKVLLTRHG ELGT+ L Sbjct: 1440 NFQDNLKVSSHPDSLKLLIHNIDLSYRLEWVGDRKVLLTRHGHELGTYPL 1489 >XP_013447113.1 transducin/WD-like repeat-protein [Medicago truncatula] KEH21140.1 transducin/WD-like repeat-protein [Medicago truncatula] Length = 1442 Score = 78.2 bits (191), Expect = 4e-14 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = -3 Query: 408 NLQENGRSLSYADSLKLLIHNLDLSYRLKWVGDRKVLLTRHGLELGTFQL 259 NLQ N + ++ DSLK L+HNLDLSYRL+WV +RKVLLTRHG ELGTFQL Sbjct: 1393 NLQNNAKDSNHVDSLKQLLHNLDLSYRLEWVAERKVLLTRHGNELGTFQL 1442 >XP_009363386.1 PREDICTED: WD repeat-containing protein 7-like [Pyrus x bretschneideri] Length = 1501 Score = 77.8 bits (190), Expect = 5e-14 Identities = 36/51 (70%), Positives = 44/51 (86%) Frame = -3 Query: 411 SNLQENGRSLSYADSLKLLIHNLDLSYRLKWVGDRKVLLTRHGLELGTFQL 259 +N+QE+ + LS AD++KLLIHNLDLSYRL+WVG RKVLLTRHG EL +F L Sbjct: 1451 ANIQESAKGLSQADNMKLLIHNLDLSYRLEWVGARKVLLTRHGQELASFPL 1501 >XP_008375960.1 PREDICTED: WD repeat-containing protein 7 [Malus domestica] Length = 1501 Score = 77.4 bits (189), Expect = 7e-14 Identities = 36/51 (70%), Positives = 44/51 (86%) Frame = -3 Query: 411 SNLQENGRSLSYADSLKLLIHNLDLSYRLKWVGDRKVLLTRHGLELGTFQL 259 +N+QE+ + LS AD++KLLIHNLDLSYRL+WVG RKVLLTRHG EL +F L Sbjct: 1451 ANIQESAKGLSQADNMKLLIHNLDLSYRLEWVGARKVLLTRHGHELASFPL 1501