BLASTX nr result
ID: Phellodendron21_contig00034076
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00034076 (327 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO42898.1 hypothetical protein CISIN_1g031928mg [Citrus sinensis] 95 1e-22 XP_006442754.1 hypothetical protein CICLE_v10022688mg [Citrus cl... 93 5e-22 XP_006370978.1 hypothetical protein POPTR_0019s02310g [Populus t... 71 2e-13 XP_006370975.1 hypothetical protein POPTR_0019s02290g [Populus t... 71 2e-13 XP_006368281.1 hypothetical protein POPTR_0001s01240g [Populus t... 67 3e-12 OMO71983.1 VQ motif-containing protein [Corchorus capsularis] 67 4e-12 XP_006375842.1 hypothetical protein POPTR_0013s04100g [Populus t... 67 4e-12 XP_002305274.1 hypothetical protein POPTR_0004s06890g [Populus t... 67 6e-12 OMO96237.1 VQ motif-containing protein [Corchorus olitorius] 67 6e-12 XP_002322895.1 hypothetical protein POPTR_0016s09710g [Populus t... 67 6e-12 XP_010102262.1 hypothetical protein L484_024544 [Morus notabilis... 67 8e-12 XP_006377608.1 hypothetical protein POPTR_0011s08310g [Populus t... 67 1e-11 OAY44276.1 hypothetical protein MANES_08G137100 [Manihot esculenta] 64 1e-10 GAV66768.1 VQ domain-containing protein [Cephalotus follicularis] 63 2e-10 XP_002521951.1 PREDICTED: sigma factor binding protein 1, chloro... 63 3e-10 XP_011468362.1 PREDICTED: uncharacterized protein LOC105352572 [... 62 3e-10 KGN60779.1 hypothetical protein Csa_2G010150 [Cucumis sativus] 62 4e-10 XP_009361997.1 PREDICTED: uncharacterized protein LOC103952175 [... 62 5e-10 XP_015866372.1 PREDICTED: uncharacterized protein LOC107403959 [... 62 7e-10 EEF40356.1 conserved hypothetical protein [Ricinus communis] 62 8e-10 >KDO42898.1 hypothetical protein CISIN_1g031928mg [Citrus sinensis] Length = 150 Score = 94.7 bits (234), Expect = 1e-22 Identities = 49/65 (75%), Positives = 54/65 (83%) Frame = +3 Query: 3 NFDDQNPNKSQRSSSNGKAAKKNPIKVTYISSPMKVKASNATEFRAIVQELTGKNSHVED 182 +FD Q NKSQRS +N KKNP+KVTYISSPMKVKASNA+EFRAIVQELTGKNS V+D Sbjct: 7 HFDHQGHNKSQRSGAN--KVKKNPLKVTYISSPMKVKASNASEFRAIVQELTGKNSEVKD 64 Query: 183 HNIYD 197 HN D Sbjct: 65 HNSDD 69 >XP_006442754.1 hypothetical protein CICLE_v10022688mg [Citrus clementina] ESR55994.1 hypothetical protein CICLE_v10022688mg [Citrus clementina] Length = 150 Score = 93.2 bits (230), Expect = 5e-22 Identities = 48/65 (73%), Positives = 54/65 (83%) Frame = +3 Query: 3 NFDDQNPNKSQRSSSNGKAAKKNPIKVTYISSPMKVKASNATEFRAIVQELTGKNSHVED 182 +FD Q N+SQRS +N KKNP+KVTYISSPMKVKASNA+EFRAIVQELTGKNS V+D Sbjct: 7 HFDHQGHNQSQRSGAN--KGKKNPLKVTYISSPMKVKASNASEFRAIVQELTGKNSEVKD 64 Query: 183 HNIYD 197 HN D Sbjct: 65 HNSDD 69 >XP_006370978.1 hypothetical protein POPTR_0019s02310g [Populus trichocarpa] ERP48775.1 hypothetical protein POPTR_0019s02310g [Populus trichocarpa] Length = 125 Score = 70.9 bits (172), Expect = 2e-13 Identities = 36/56 (64%), Positives = 43/56 (76%) Frame = +3 Query: 15 QNPNKSQRSSSNGKAAKKNPIKVTYISSPMKVKASNATEFRAIVQELTGKNSHVED 182 + P K Q+S+ N K+ PIK+ YISSP VKA+NATEFRAIVQELTGK+S VED Sbjct: 13 EQPKKGQKSTKN----KREPIKIKYISSPTMVKATNATEFRAIVQELTGKDSKVED 64 >XP_006370975.1 hypothetical protein POPTR_0019s02290g [Populus trichocarpa] ERP48772.1 hypothetical protein POPTR_0019s02290g [Populus trichocarpa] Length = 126 Score = 70.9 bits (172), Expect = 2e-13 Identities = 36/56 (64%), Positives = 43/56 (76%) Frame = +3 Query: 15 QNPNKSQRSSSNGKAAKKNPIKVTYISSPMKVKASNATEFRAIVQELTGKNSHVED 182 + P K Q+S+ N K+ PIK+ YISSP VKA+NATEFRAIVQELTGK+S VED Sbjct: 13 EQPKKGQKSTKN----KREPIKIKYISSPTMVKATNATEFRAIVQELTGKDSKVED 64 >XP_006368281.1 hypothetical protein POPTR_0001s01240g [Populus trichocarpa] ERP64850.1 hypothetical protein POPTR_0001s01240g [Populus trichocarpa] Length = 105 Score = 67.0 bits (162), Expect = 3e-12 Identities = 32/49 (65%), Positives = 38/49 (77%) Frame = +3 Query: 36 RSSSNGKAAKKNPIKVTYISSPMKVKASNATEFRAIVQELTGKNSHVED 182 R N +K P+K+TYISSPM VKA+NA+EFR IVQELTGK+S VED Sbjct: 15 RRGKNPTKHRKEPVKITYISSPMMVKATNASEFRVIVQELTGKDSKVED 63 >OMO71983.1 VQ motif-containing protein [Corchorus capsularis] Length = 131 Score = 67.4 bits (163), Expect = 4e-12 Identities = 34/54 (62%), Positives = 37/54 (68%) Frame = +3 Query: 42 SSNGKAAKKNPIKVTYISSPMKVKASNATEFRAIVQELTGKNSHVEDHNIYDNH 203 S N KKNPIKVTYI SP VK SNA EFRAIVQELTG+NS + + D H Sbjct: 17 SKNPTKVKKNPIKVTYIDSPTMVKVSNADEFRAIVQELTGRNSDTREQHSNDVH 70 >XP_006375842.1 hypothetical protein POPTR_0013s04100g [Populus trichocarpa] ERP53639.1 hypothetical protein POPTR_0013s04100g [Populus trichocarpa] Length = 121 Score = 67.0 bits (162), Expect = 4e-12 Identities = 33/56 (58%), Positives = 43/56 (76%) Frame = +3 Query: 15 QNPNKSQRSSSNGKAAKKNPIKVTYISSPMKVKASNATEFRAIVQELTGKNSHVED 182 Q P + ++ + + KK P+K+TYISSP VKA+NA+EFRAIVQELTGK+S VED Sbjct: 12 QEPRRGKKPTKH----KKEPVKITYISSPTMVKATNASEFRAIVQELTGKDSKVED 63 >XP_002305274.1 hypothetical protein POPTR_0004s06890g [Populus trichocarpa] EEE85785.1 hypothetical protein POPTR_0004s06890g [Populus trichocarpa] Length = 131 Score = 67.0 bits (162), Expect = 6e-12 Identities = 33/56 (58%), Positives = 43/56 (76%) Frame = +3 Query: 15 QNPNKSQRSSSNGKAAKKNPIKVTYISSPMKVKASNATEFRAIVQELTGKNSHVED 182 Q P + ++ + + KK P+K+TYISSP VKA+NA+EFRAIVQELTGK+S VED Sbjct: 12 QEPRRGKKPTKH----KKEPVKITYISSPTMVKATNASEFRAIVQELTGKDSKVED 63 >OMO96237.1 VQ motif-containing protein [Corchorus olitorius] Length = 137 Score = 67.0 bits (162), Expect = 6e-12 Identities = 34/54 (62%), Positives = 38/54 (70%) Frame = +3 Query: 42 SSNGKAAKKNPIKVTYISSPMKVKASNATEFRAIVQELTGKNSHVEDHNIYDNH 203 S N KKNPIKVTYI+SP VK SNA EFRAIVQELTG+NS + + D H Sbjct: 18 SKNPIKVKKNPIKVTYIASPTMVKVSNADEFRAIVQELTGRNSDTREQHSNDVH 71 >XP_002322895.1 hypothetical protein POPTR_0016s09710g [Populus trichocarpa] EEF04656.1 hypothetical protein POPTR_0016s09710g [Populus trichocarpa] Length = 138 Score = 67.0 bits (162), Expect = 6e-12 Identities = 33/56 (58%), Positives = 43/56 (76%) Frame = +3 Query: 15 QNPNKSQRSSSNGKAAKKNPIKVTYISSPMKVKASNATEFRAIVQELTGKNSHVED 182 Q P + ++ + + KK P+K+TYISSP VKA+NA+EFRAIVQELTGK+S VED Sbjct: 12 QEPRRGKKPTKH----KKEPVKITYISSPTMVKATNASEFRAIVQELTGKDSKVED 63 >XP_010102262.1 hypothetical protein L484_024544 [Morus notabilis] EXB93205.1 hypothetical protein L484_024544 [Morus notabilis] Length = 165 Score = 67.4 bits (163), Expect = 8e-12 Identities = 37/62 (59%), Positives = 48/62 (77%), Gaps = 1/62 (1%) Frame = +3 Query: 18 NPN-KSQRSSSNGKAAKKNPIKVTYISSPMKVKASNATEFRAIVQELTGKNSHVEDHNIY 194 NP+ +SQ+ S GK K PIK+ YISSPM V+A+NA+EFRAIVQELTG+NS+ D +Y Sbjct: 15 NPHLRSQKQPSKGK---KKPIKIKYISSPMMVRANNASEFRAIVQELTGRNSNYTD--LY 69 Query: 195 DN 200 D+ Sbjct: 70 DD 71 >XP_006377608.1 hypothetical protein POPTR_0011s08310g [Populus trichocarpa] ERP55405.1 hypothetical protein POPTR_0011s08310g [Populus trichocarpa] Length = 166 Score = 67.0 bits (162), Expect = 1e-11 Identities = 33/56 (58%), Positives = 43/56 (76%) Frame = +3 Query: 15 QNPNKSQRSSSNGKAAKKNPIKVTYISSPMKVKASNATEFRAIVQELTGKNSHVED 182 Q P + ++ + + KK P+K+TYISSP VKA+NA+EFRAIVQELTGK+S VED Sbjct: 12 QEPRRGKKPTKH----KKEPVKITYISSPTMVKATNASEFRAIVQELTGKDSKVED 63 >OAY44276.1 hypothetical protein MANES_08G137100 [Manihot esculenta] Length = 128 Score = 63.5 bits (153), Expect = 1e-10 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = +3 Query: 27 KSQRSSSNGKAAKKNPIKVTYISSPMKVKASNATEFRAIVQELTGKNSHVED 182 +SQ+ S N KK P+KVTYIS+P V+A+NA+EFRAIVQELTGK+S + D Sbjct: 13 RSQKPSKN----KKKPVKVTYISNPTMVRATNASEFRAIVQELTGKDSKIVD 60 >GAV66768.1 VQ domain-containing protein [Cephalotus follicularis] Length = 128 Score = 63.2 bits (152), Expect = 2e-10 Identities = 32/57 (56%), Positives = 40/57 (70%) Frame = +3 Query: 12 DQNPNKSQRSSSNGKAAKKNPIKVTYISSPMKVKASNATEFRAIVQELTGKNSHVED 182 D + +S K K +PIKVT+ISSPM VKASN +EFRAIVQELTG+ S++ D Sbjct: 6 DNQYHHDHKSQKLTKVKKNDPIKVTHISSPMLVKASNPSEFRAIVQELTGQYSNIND 62 >XP_002521951.1 PREDICTED: sigma factor binding protein 1, chloroplastic [Ricinus communis] EEF40355.1 conserved hypothetical protein [Ricinus communis] Length = 133 Score = 62.8 bits (151), Expect = 3e-10 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = +3 Query: 27 KSQRSSSNGKAAKKNPIKVTYISSPMKVKASNATEFRAIVQELTGKNSHVED 182 KSQ+ + N KK P+K+TYIS+P V+A+NA+EFRAIVQELTGK+S V D Sbjct: 16 KSQKHTKN----KKKPVKITYISNPTLVRATNASEFRAIVQELTGKDSKVLD 63 >XP_011468362.1 PREDICTED: uncharacterized protein LOC105352572 [Fragaria vesca subsp. vesca] Length = 131 Score = 62.4 bits (150), Expect = 3e-10 Identities = 30/56 (53%), Positives = 42/56 (75%), Gaps = 2/56 (3%) Frame = +3 Query: 24 NKSQRSSSNGKAAKKNPIKVTYISSPMKVKASNATEFRAIVQELTGKNSH--VEDH 185 N+ QR+ ++ + PI++ YISSPM V+A+NA+EFRAIVQELTG+NS + DH Sbjct: 9 NRQQRTERRKRSKAETPIRIKYISSPMMVQANNASEFRAIVQELTGQNSDATIPDH 64 >KGN60779.1 hypothetical protein Csa_2G010150 [Cucumis sativus] Length = 139 Score = 62.4 bits (150), Expect = 4e-10 Identities = 30/56 (53%), Positives = 41/56 (73%) Frame = +3 Query: 6 FDDQNPNKSQRSSSNGKAAKKNPIKVTYISSPMKVKASNATEFRAIVQELTGKNSH 173 + + N ++SQ + N ++ PIKV YISSPM +KASNA EFRAIVQ+LTG +S+ Sbjct: 9 YTNHNHSQSQSQNQNPTKVQRKPIKVKYISSPMMIKASNALEFRAIVQQLTGFDSN 64 >XP_009361997.1 PREDICTED: uncharacterized protein LOC103952175 [Pyrus x bretschneideri] Length = 129 Score = 62.0 bits (149), Expect = 5e-10 Identities = 41/88 (46%), Positives = 57/88 (64%), Gaps = 4/88 (4%) Frame = +3 Query: 15 QNPNKSQRSSSNGKAAKKNPIKVTYISSPMKVKASNATEFRAIVQELTGKNS----HVED 182 ++P +S+RS S G +KV YISSPMKVK S A+EFRA+VQELTG++S +E Sbjct: 9 KSPKQSKRSRSKGG------VKVVYISSPMKVKTS-ASEFRALVQELTGRHSDAERFMET 61 Query: 183 HNIYDNHQQYYFL*LKKKESHKQRLLVL 266 +N +HQQ ++SH+QRL V+ Sbjct: 62 NNSGQHHQQNV-----HEDSHEQRLKVV 84 >XP_015866372.1 PREDICTED: uncharacterized protein LOC107403959 [Ziziphus jujuba] Length = 167 Score = 62.4 bits (150), Expect = 7e-10 Identities = 29/52 (55%), Positives = 41/52 (78%) Frame = +3 Query: 27 KSQRSSSNGKAAKKNPIKVTYISSPMKVKASNATEFRAIVQELTGKNSHVED 182 + ++SS NGK+ K P++V YIS+PMKVK S A EFRA+VQELTG+++ + D Sbjct: 13 QQRKSSKNGKSKKSKPVRVVYISNPMKVKTS-AAEFRALVQELTGQDAEIPD 63 >EEF40356.1 conserved hypothetical protein [Ricinus communis] Length = 136 Score = 61.6 bits (148), Expect = 8e-10 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = +3 Query: 48 NGKAAKKNPIKVTYISSPMKVKASNATEFRAIVQELTGKNSHVEDH 185 N +K PIK+TYISSP V+A+NA+EFRAIVQELTGK+S V D+ Sbjct: 21 NPSKNRKKPIKITYISSPTMVRAANASEFRAIVQELTGKDSKVLDN 66