BLASTX nr result
ID: Phellodendron21_contig00033976
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00033976 (280 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDP35439.1 hypothetical protein JCGZ_10822 [Jatropha curcas] 89 1e-21 AEW09189.1 hypothetical protein CL4606Contig1_03, partial [Pinus... 88 2e-21 KCW57953.1 hypothetical protein EUGRSUZ_H00688 [Eucalyptus grandis] 89 2e-21 OEL14741.1 Dolichyl-diphosphooligosaccharide--protein glycosyltr... 88 3e-21 XP_020113042.1 dolichyl-diphosphooligosaccharide--protein glycos... 89 4e-21 JAT67322.1 Defender against cell death 1 [Anthurium amnicola] JA... 89 4e-21 OAY22329.1 hypothetical protein MANES_S009900 [Manihot esculenta] 89 4e-21 OAY21629.1 hypothetical protein MANES_S071300 [Manihot esculenta] 89 4e-21 XP_015574448.1 PREDICTED: dolichyl-diphosphooligosaccharide--pro... 89 4e-21 XP_012075090.1 PREDICTED: dolichyl-diphosphooligosaccharide--pro... 89 4e-21 XP_011028107.1 PREDICTED: dolichyl-diphosphooligosaccharide--pro... 89 4e-21 XP_011018485.1 PREDICTED: dolichyl-diphosphooligosaccharide--pro... 89 4e-21 XP_010276817.1 PREDICTED: dolichyl-diphosphooligosaccharide--pro... 89 4e-21 XP_009409930.1 PREDICTED: dolichyl-diphosphooligosaccharide--pro... 89 4e-21 XP_008786425.1 PREDICTED: dolichyl-diphosphooligosaccharide--pro... 89 4e-21 AID23887.1 defender against death domain 1 [Musa ABB Group] 89 4e-21 XP_010069569.1 PREDICTED: dolichyl-diphosphooligosaccharide--pro... 89 4e-21 XP_006368353.1 Defender against cell death 1 family protein [Pop... 89 4e-21 XP_002303440.1 Defender against cell death 1 family protein [Pop... 89 4e-21 AAO73434.1 DAD1 [Petunia x hybrida] 89 4e-21 >KDP35439.1 hypothetical protein JCGZ_10822 [Jatropha curcas] Length = 68 Score = 89.4 bits (220), Expect = 1e-21 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -2 Query: 279 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 154 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG Sbjct: 27 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 68 >AEW09189.1 hypothetical protein CL4606Contig1_03, partial [Pinus radiata] AFG70018.1 hypothetical protein CL4606Contig1_03, partial [Pinus taeda] AFG70019.1 hypothetical protein CL4606Contig1_03, partial [Pinus taeda] AFG70020.1 hypothetical protein CL4606Contig1_03, partial [Pinus taeda] AFG70021.1 hypothetical protein CL4606Contig1_03, partial [Pinus taeda] AFG70022.1 hypothetical protein CL4606Contig1_03, partial [Pinus taeda] AFG70023.1 hypothetical protein CL4606Contig1_03, partial [Pinus taeda] AFG70024.1 hypothetical protein CL4606Contig1_03, partial [Pinus taeda] AFG70025.1 hypothetical protein CL4606Contig1_03, partial [Pinus taeda] AFG70026.1 hypothetical protein CL4606Contig1_03, partial [Pinus taeda] AFG70027.1 hypothetical protein CL4606Contig1_03, partial [Pinus taeda] AFG70028.1 hypothetical protein CL4606Contig1_03, partial [Pinus taeda] AFG70029.1 hypothetical protein CL4606Contig1_03, partial [Pinus taeda] AFG70030.1 hypothetical protein CL4606Contig1_03, partial [Pinus taeda] AFG70031.1 hypothetical protein CL4606Contig1_03, partial [Pinus taeda] AFG70032.1 hypothetical protein CL4606Contig1_03, partial [Pinus taeda] AFG70033.1 hypothetical protein CL4606Contig1_03, partial [Pinus taeda] AFG70034.1 hypothetical protein CL4606Contig1_03, partial [Pinus taeda] AFG70035.1 hypothetical protein CL4606Contig1_03, partial [Pinus taeda] Length = 54 Score = 88.2 bits (217), Expect = 2e-21 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -2 Query: 279 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 154 VCLR+QVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG Sbjct: 13 VCLRMQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 54 >KCW57953.1 hypothetical protein EUGRSUZ_H00688 [Eucalyptus grandis] Length = 96 Score = 89.4 bits (220), Expect = 2e-21 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -2 Query: 279 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 154 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG Sbjct: 55 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 96 >OEL14741.1 Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 [Dichanthelium oligosanthes] Length = 68 Score = 88.2 bits (217), Expect = 3e-21 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -2 Query: 279 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 154 VCLRIQVNK+NKEFKDLPPERAFADFVLCNLVLHLVIMNFLG Sbjct: 27 VCLRIQVNKDNKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 68 >XP_020113042.1 dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 [Ananas comosus] OAY68530.1 Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 [Ananas comosus] Length = 114 Score = 89.4 bits (220), Expect = 4e-21 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -2 Query: 279 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 154 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG Sbjct: 73 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 114 >JAT67322.1 Defender against cell death 1 [Anthurium amnicola] JAT67559.1 Defender against cell death 1 [Anthurium amnicola] Length = 115 Score = 89.4 bits (220), Expect = 4e-21 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -2 Query: 279 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 154 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG Sbjct: 74 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 115 >OAY22329.1 hypothetical protein MANES_S009900 [Manihot esculenta] Length = 115 Score = 89.4 bits (220), Expect = 4e-21 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -2 Query: 279 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 154 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG Sbjct: 74 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 115 >OAY21629.1 hypothetical protein MANES_S071300 [Manihot esculenta] Length = 115 Score = 89.4 bits (220), Expect = 4e-21 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -2 Query: 279 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 154 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG Sbjct: 74 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 115 >XP_015574448.1 PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 [Ricinus communis] Length = 115 Score = 89.4 bits (220), Expect = 4e-21 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -2 Query: 279 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 154 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG Sbjct: 74 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 115 >XP_012075090.1 PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 isoform X2 [Jatropha curcas] Length = 115 Score = 89.4 bits (220), Expect = 4e-21 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -2 Query: 279 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 154 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG Sbjct: 74 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 115 >XP_011028107.1 PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 [Populus euphratica] Length = 115 Score = 89.4 bits (220), Expect = 4e-21 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -2 Query: 279 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 154 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG Sbjct: 74 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 115 >XP_011018485.1 PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 [Populus euphratica] Length = 115 Score = 89.4 bits (220), Expect = 4e-21 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -2 Query: 279 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 154 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG Sbjct: 74 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 115 >XP_010276817.1 PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 [Nelumbo nucifera] Length = 115 Score = 89.4 bits (220), Expect = 4e-21 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -2 Query: 279 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 154 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG Sbjct: 74 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 115 >XP_009409930.1 PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 [Musa acuminata subsp. malaccensis] Length = 115 Score = 89.4 bits (220), Expect = 4e-21 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -2 Query: 279 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 154 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG Sbjct: 74 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 115 >XP_008786425.1 PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1-like [Phoenix dactylifera] Length = 115 Score = 89.4 bits (220), Expect = 4e-21 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -2 Query: 279 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 154 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG Sbjct: 74 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 115 >AID23887.1 defender against death domain 1 [Musa ABB Group] Length = 115 Score = 89.4 bits (220), Expect = 4e-21 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -2 Query: 279 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 154 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG Sbjct: 74 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 115 >XP_010069569.1 PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 [Eucalyptus grandis] EEB94905.1 hypothetical protein MPER_06208 [Moniliophthora perniciosa FA553] KCW57952.1 hypothetical protein EUGRSUZ_H00688 [Eucalyptus grandis] Length = 115 Score = 89.4 bits (220), Expect = 4e-21 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -2 Query: 279 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 154 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG Sbjct: 74 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 115 >XP_006368353.1 Defender against cell death 1 family protein [Populus trichocarpa] ERP64922.1 Defender against cell death 1 family protein [Populus trichocarpa] Length = 115 Score = 89.4 bits (220), Expect = 4e-21 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -2 Query: 279 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 154 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG Sbjct: 74 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 115 >XP_002303440.1 Defender against cell death 1 family protein [Populus trichocarpa] ABK93501.1 unknown [Populus trichocarpa] ABK95181.1 unknown [Populus trichocarpa] EEE78419.1 Defender against cell death 1 family protein [Populus trichocarpa] Length = 115 Score = 89.4 bits (220), Expect = 4e-21 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -2 Query: 279 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 154 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG Sbjct: 74 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 115 >AAO73434.1 DAD1 [Petunia x hybrida] Length = 116 Score = 89.4 bits (220), Expect = 4e-21 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -2 Query: 279 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 154 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG Sbjct: 75 VCLRIQVNKENKEFKDLPPERAFADFVLCNLVLHLVIMNFLG 116