BLASTX nr result
ID: Phellodendron21_contig00033901
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00033901 (334 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007418498.1 hypothetical protein MELLADRAFT_96067 [Melampsora... 65 7e-10 >XP_007418498.1 hypothetical protein MELLADRAFT_96067 [Melampsora larici-populina 98AG31] EGF98226.1 hypothetical protein MELLADRAFT_96067 [Melampsora larici-populina 98AG31] Length = 1513 Score = 64.7 bits (156), Expect = 7e-10 Identities = 39/101 (38%), Positives = 56/101 (55%), Gaps = 4/101 (3%) Frame = +3 Query: 42 AGQLPAVDWSAXXXXXXXXXXXXXXXXXXXXDFDAAHFDPSSATLLSVSPTSQS----LE 209 + QLP +DWSA FDPS +T++S+ +SQS L Sbjct: 35 SSQLPIIDWSALGNVALLGSFSGLSIYNASTSNST--FDPSHSTIISLDTSSQSEPQPLI 92 Query: 210 PIATTNKGGSINVICPTSDPNQIYIGGSFSSLNSQNGFANI 332 + TTN+GGSI+ IC ++ N++YIGGSF+S+NS N +NI Sbjct: 93 SLGTTNQGGSIHTICQSN--NKLYIGGSFNSINSVNPLSNI 131