BLASTX nr result
ID: Phellodendron21_contig00033845
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00033845 (456 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010055266.1 PREDICTED: probable transcription factor KAN2 [Eu... 46 3e-06 KCW71743.1 hypothetical protein EUGRSUZ_E00246 [Eucalyptus grandis] 46 5e-06 XP_010055276.1 PREDICTED: probable transcription factor KAN2 iso... 46 5e-06 >XP_010055266.1 PREDICTED: probable transcription factor KAN2 [Eucalyptus grandis] KCW71727.1 hypothetical protein EUGRSUZ_E00234 [Eucalyptus grandis] Length = 388 Score = 46.2 bits (108), Expect(2) = 3e-06 Identities = 25/41 (60%), Positives = 33/41 (80%), Gaps = 2/41 (4%) Frame = +1 Query: 265 AEEEIDLGFWSRALDSRTNPNMSSSMAA-NRAR-DSSISEP 381 AEE+++LGFW RALDSR++ ++ SSMAA N AR D S+S P Sbjct: 28 AEEDVNLGFWKRALDSRSHHSLPSSMAAKNDARFDLSLSNP 68 Score = 32.0 bits (71), Expect(2) = 3e-06 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = +2 Query: 212 MELFPAQPDLSLQIXESELK 271 MELFPAQPDLSLQI K Sbjct: 1 MELFPAQPDLSLQISPPNAK 20 >KCW71743.1 hypothetical protein EUGRSUZ_E00246 [Eucalyptus grandis] Length = 346 Score = 46.2 bits (108), Expect(2) = 5e-06 Identities = 25/41 (60%), Positives = 33/41 (80%), Gaps = 2/41 (4%) Frame = +1 Query: 265 AEEEIDLGFWSRALDSRTNPNMSSSMAA-NRAR-DSSISEP 381 AEE+++LGFW RALDSR++ ++ SSMAA N AR D S+S P Sbjct: 28 AEEDVNLGFWKRALDSRSHHSLPSSMAAKNDARFDLSLSNP 68 Score = 31.2 bits (69), Expect(2) = 5e-06 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = +2 Query: 212 MELFPAQPDLSLQIXESELK 271 ME+FPAQPDLSLQI K Sbjct: 1 MEIFPAQPDLSLQISPPNAK 20 >XP_010055276.1 PREDICTED: probable transcription factor KAN2 isoform X1 [Eucalyptus grandis] KCW71744.1 hypothetical protein EUGRSUZ_E00246 [Eucalyptus grandis] Length = 328 Score = 46.2 bits (108), Expect(2) = 5e-06 Identities = 25/41 (60%), Positives = 33/41 (80%), Gaps = 2/41 (4%) Frame = +1 Query: 265 AEEEIDLGFWSRALDSRTNPNMSSSMAA-NRAR-DSSISEP 381 AEE+++LGFW RALDSR++ ++ SSMAA N AR D S+S P Sbjct: 28 AEEDVNLGFWKRALDSRSHHSLPSSMAAKNDARFDLSLSNP 68 Score = 31.2 bits (69), Expect(2) = 5e-06 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = +2 Query: 212 MELFPAQPDLSLQIXESELK 271 ME+FPAQPDLSLQI K Sbjct: 1 MEIFPAQPDLSLQISPPNAK 20