BLASTX nr result
ID: Phellodendron21_contig00033813
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00033813 (438 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007416388.1 hypothetical protein MELLADRAFT_111926 [Melampsor... 69 6e-11 >XP_007416388.1 hypothetical protein MELLADRAFT_111926 [Melampsora larici-populina 98AG31] EGG00369.1 hypothetical protein MELLADRAFT_111926 [Melampsora larici-populina 98AG31] Length = 388 Score = 68.9 bits (167), Expect = 6e-11 Identities = 28/42 (66%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = +1 Query: 1 LLPISGLWAVQPPDGFQWVPSERWYIDHDSST-DEEGWHFVN 123 L P +GLWAVQPPDGFQW+P+E W+IDH SS D+ GW+ VN Sbjct: 323 LQPTAGLWAVQPPDGFQWIPTEGWHIDHTSSNLDQHGWNLVN 364