BLASTX nr result
ID: Phellodendron21_contig00033753
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00033753 (303 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CEH11860.1 histone h3 [Ceraceosorus bombacis] 163 1e-49 KZL65057.1 histone H3, partial [Colletotrichum tofieldiae] 160 2e-48 XP_018152220.1 histone H3 [Colletotrichum higginsianum IMI 34906... 162 4e-48 XP_001727504.2 histone H3 [Aspergillus oryzae RIB40] 157 9e-48 XP_019841096.1 PREDICTED: histone H3.1-like [Bos indicus] 158 2e-47 KZS11140.1 histone H3.3 [Daphnia magna] 157 2e-47 ADO60142.1 histone H3, partial [Beauveria bassiana] 156 3e-47 ODQ72755.1 hypothetical protein LIPSTDRAFT_72383 [Lipomyces star... 156 3e-47 OAA55970.1 histone H3 [Sporothrix insectorum RCEF 264] 156 3e-47 AMD39021.1 histone H3 [Fusarium bulbicola] 156 3e-47 CRK42576.1 hypothetical protein BN1723_005378 [Verticillium long... 156 3e-47 CEJ87566.1 Putative Histone H3 [Torrubiella hemipterigena] 156 3e-47 XP_006672653.1 histone H3 [Cordyceps militaris CM01] XP_00860335... 156 3e-47 NP_001106556.1 histone cluster 1, H3g protein [Xenopus tropicali... 156 3e-47 XP_001548662.1 histone H3 [Botrytis cinerea B05.10] XP_001589886... 156 3e-47 BAD90774.1 histone 3 [Conocephalum supradecompositum] 156 3e-47 BAD90802.1 histone 3 [Conocephalum conicum] 156 3e-47 BAD90790.1 histone 3 [Marchantia polymorpha] 156 3e-47 BAD90769.1 histone 3 [Conocephalum supradecompositum] 156 3e-47 BAD90759.1 histone 3 [Conocephalum conicum] 156 3e-47 >CEH11860.1 histone h3 [Ceraceosorus bombacis] Length = 155 Score = 163 bits (412), Expect = 1e-49 Identities = 83/95 (87%), Positives = 88/95 (92%) Frame = -3 Query: 286 KHLHLQQPSTTLPSLTMARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKP 107 +H H+ QPS S+TMARTKQTARKSTGGKAPRKQLA+KAARKSAPS GGVKKPHRY+P Sbjct: 6 QHSHITQPSNN--SVTMARTKQTARKSTGGKAPRKQLATKAARKSAPSAGGVKKPHRYRP 63 Query: 106 GTVALREIRRYQKSTELLIRKLPFQRLVREIAQDF 2 GTVALREIRRYQKSTELLIRKLPFQRLVREIAQDF Sbjct: 64 GTVALREIRRYQKSTELLIRKLPFQRLVREIAQDF 98 >KZL65057.1 histone H3, partial [Colletotrichum tofieldiae] Length = 168 Score = 160 bits (405), Expect = 2e-48 Identities = 85/100 (85%), Positives = 89/100 (89%) Frame = -3 Query: 301 TNNLLKHLHLQQPSTTLPSLTMARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKP 122 TN L +H Q S+ ++ MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKP Sbjct: 13 TNQLHQHKQSHQLSSHT-TVAMARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKP 71 Query: 121 HRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDF 2 HRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDF Sbjct: 72 HRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDF 111 >XP_018152220.1 histone H3 [Colletotrichum higginsianum IMI 349063] OBR03702.1 histone H3 [Colletotrichum higginsianum IMI 349063] Length = 262 Score = 162 bits (411), Expect = 4e-48 Identities = 84/107 (78%), Positives = 91/107 (85%), Gaps = 12/107 (11%) Frame = -3 Query: 286 KHLHLQQPSTTL------------PSLTMARTKQTARKSTGGKAPRKQLASKAARKSAPS 143 +H+H+QQP+ + ++ MARTKQTARKSTGGKAPRKQLASKAARKSAPS Sbjct: 99 QHIHIQQPTNFINNFQQTHQLHHHTTVAMARTKQTARKSTGGKAPRKQLASKAARKSAPS 158 Query: 142 TGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDF 2 TGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDF Sbjct: 159 TGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDF 205 >XP_001727504.2 histone H3 [Aspergillus oryzae RIB40] Length = 139 Score = 157 bits (398), Expect = 9e-48 Identities = 80/82 (97%), Positives = 81/82 (98%) Frame = -3 Query: 247 SLTMARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQK 68 SL MARTKQTARKSTGGKAPRKQLASKAARK+APSTGGVKKPHRYKPGTVALREIRRYQK Sbjct: 1 SLKMARTKQTARKSTGGKAPRKQLASKAARKAAPSTGGVKKPHRYKPGTVALREIRRYQK 60 Query: 67 STELLIRKLPFQRLVREIAQDF 2 STELLIRKLPFQRLVREIAQDF Sbjct: 61 STELLIRKLPFQRLVREIAQDF 82 >XP_019841096.1 PREDICTED: histone H3.1-like [Bos indicus] Length = 176 Score = 158 bits (399), Expect = 2e-47 Identities = 79/89 (88%), Positives = 85/89 (95%) Frame = -3 Query: 268 QPSTTLPSLTMARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALR 89 +P ++ SL MARTKQTARKSTGGKAPRKQLA+KAARKSAP+TGGVKKPHRY+PGTVALR Sbjct: 31 RPLVSVHSLVMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALR 90 Query: 88 EIRRYQKSTELLIRKLPFQRLVREIAQDF 2 EIRRYQKSTELLIRKLPFQRLVREIAQDF Sbjct: 91 EIRRYQKSTELLIRKLPFQRLVREIAQDF 119 >KZS11140.1 histone H3.3 [Daphnia magna] Length = 159 Score = 157 bits (397), Expect = 2e-47 Identities = 79/84 (94%), Positives = 82/84 (97%) Frame = -3 Query: 253 LPSLTMARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRY 74 LP L MARTKQTARKSTGGKAPRKQLA+KAARKSAP+TGGVKKPHRY+PGTVALREIRRY Sbjct: 19 LPFLKMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRY 78 Query: 73 QKSTELLIRKLPFQRLVREIAQDF 2 QKSTELLIRKLPFQRLVREIAQDF Sbjct: 79 QKSTELLIRKLPFQRLVREIAQDF 102 >ADO60142.1 histone H3, partial [Beauveria bassiana] Length = 128 Score = 156 bits (394), Expect = 3e-47 Identities = 79/79 (100%), Positives = 79/79 (100%) Frame = -3 Query: 238 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 59 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 60 Query: 58 LLIRKLPFQRLVREIAQDF 2 LLIRKLPFQRLVREIAQDF Sbjct: 61 LLIRKLPFQRLVREIAQDF 79 >ODQ72755.1 hypothetical protein LIPSTDRAFT_72383 [Lipomyces starkeyi NRRL Y-11557] Length = 136 Score = 156 bits (394), Expect = 3e-47 Identities = 79/79 (100%), Positives = 79/79 (100%) Frame = -3 Query: 238 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 59 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 60 Query: 58 LLIRKLPFQRLVREIAQDF 2 LLIRKLPFQRLVREIAQDF Sbjct: 61 LLIRKLPFQRLVREIAQDF 79 >OAA55970.1 histone H3 [Sporothrix insectorum RCEF 264] Length = 136 Score = 156 bits (394), Expect = 3e-47 Identities = 79/79 (100%), Positives = 79/79 (100%) Frame = -3 Query: 238 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 59 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 60 Query: 58 LLIRKLPFQRLVREIAQDF 2 LLIRKLPFQRLVREIAQDF Sbjct: 61 LLIRKLPFQRLVREIAQDF 79 >AMD39021.1 histone H3 [Fusarium bulbicola] Length = 136 Score = 156 bits (394), Expect = 3e-47 Identities = 79/79 (100%), Positives = 79/79 (100%) Frame = -3 Query: 238 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 59 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 60 Query: 58 LLIRKLPFQRLVREIAQDF 2 LLIRKLPFQRLVREIAQDF Sbjct: 61 LLIRKLPFQRLVREIAQDF 79 >CRK42576.1 hypothetical protein BN1723_005378 [Verticillium longisporum] Length = 136 Score = 156 bits (394), Expect = 3e-47 Identities = 79/79 (100%), Positives = 79/79 (100%) Frame = -3 Query: 238 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 59 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 60 Query: 58 LLIRKLPFQRLVREIAQDF 2 LLIRKLPFQRLVREIAQDF Sbjct: 61 LLIRKLPFQRLVREIAQDF 79 >CEJ87566.1 Putative Histone H3 [Torrubiella hemipterigena] Length = 136 Score = 156 bits (394), Expect = 3e-47 Identities = 79/79 (100%), Positives = 79/79 (100%) Frame = -3 Query: 238 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 59 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 60 Query: 58 LLIRKLPFQRLVREIAQDF 2 LLIRKLPFQRLVREIAQDF Sbjct: 61 LLIRKLPFQRLVREIAQDF 79 >XP_006672653.1 histone H3 [Cordyceps militaris CM01] XP_008603353.1 histone H3 [Beauveria bassiana ARSEF 2860] XP_018702717.1 histone H3 [Isaria fumosorosea ARSEF 2679] EGX89197.1 histone H3 [Cordyceps militaris CM01] EJP61020.1 histone H3 [Beauveria bassiana ARSEF 2860] KGQ02742.1 Histone H3 [Beauveria bassiana D1-5] OAA36992.1 histone H3 [Cordyceps brongniartii RCEF 3172] OAA58842.1 histone H3 [Isaria fumosorosea ARSEF 2679] OAA76327.1 histone H3 [Cordyceps confragosa RCEF 1005] OAR02498.1 hypothetical protein LLEC1_06206 [Cordyceps confragosa] Length = 136 Score = 156 bits (394), Expect = 3e-47 Identities = 79/79 (100%), Positives = 79/79 (100%) Frame = -3 Query: 238 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 59 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 60 Query: 58 LLIRKLPFQRLVREIAQDF 2 LLIRKLPFQRLVREIAQDF Sbjct: 61 LLIRKLPFQRLVREIAQDF 79 >NP_001106556.1 histone cluster 1, H3g protein [Xenopus tropicalis] XP_003851442.1 histone H3 [Zymoseptoria tritici IPO323] XP_007295303.1 histone cluster 1, H3g [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] XP_007676780.1 hypothetical protein BAUCODRAFT_34428 [Baudoinia panamericana UAMH 10762] XP_007723998.1 histone H3 [Capronia coronata CBS 617.96] XP_007731960.1 histone H3 [Capronia epimyces CBS 606.96] XP_007759802.1 histone H3 [Cladophialophora yegresii CBS 114405] XP_007740993.1 histone H3 [Cladophialophora psammophila CBS 110553] XP_007787317.1 Histone H3 [Endocarpon pusillum Z07020] XP_007928076.1 hypothetical protein MYCFIDRAFT_76942 [Pseudocercospora fijiensis CIRAD86] XP_008087110.1 Histone-fold containing protein [Glarea lozoyensis ATCC 20868] XP_007780895.1 histone H3 [Coniosporium apollinis CBS 100218] XP_008725039.1 histone H3 [Cladophialophora carrionii CBS 160.54] XP_009154089.1 histone H3 [Exophiala dermatitidis NIH/UT8656] XP_012740301.1 histone H3 [Pseudogymnoascus destructans 20631-21] XP_013270500.1 histone H3 [Rhinocladiella mackenziei CBS 650.93] XP_013287775.1 histone H3 [Fonsecaea pedrosoi CBS 271.37] XP_013314048.1 histone H3 [Exophiala xenobiotica] XP_013343568.1 hypothetical protein AUEXF2481DRAFT_47053 [Aureobasidium subglaciale EXF-2481] XP_013428903.1 histone cluster 1, H3g protein [Aureobasidium namibiae CBS 147.97] XP_016226481.1 histone H3 [Exophiala mesophila] XP_016215309.1 histone H3 [Verruconis gallopava] XP_016230789.1 histone H3 [Exophiala spinifera] XP_016266785.1 histone H3 [Exophiala oligosperma] XP_016243834.1 histone H3 [Cladophialophora immunda] XP_016637803.1 histone H3 [Fonsecaea multimorphosa CBS 102226] XP_016624376.1 histone H3 [Cladophialophora bantiana CBS 173.52] XP_018077284.1 histone cluster 1, H3g protein [Phialocephala scopiformis] XP_018128005.1 histone H3 [Pseudogymnoascus verrucosus] XP_018190764.1 histone cluster 1, H3g protein [Xylona heveae TC161] XP_018696518.1 histone H3 [Fonsecaea erecta] AAI54937.1 LOC100127748 protein [Xenopus tropicalis] EGP86418.1 histone H3 [Zymoseptoria tritici IPO323] EHK97637.1 putative Histone H3 [Glarea lozoyensis 74030] EHY53628.1 histone H3 [Exophiala dermatitidis NIH/UT8656] EKD14693.1 histone cluster 1, H3g [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] ELR05822.1 histone H3 [Pseudogymnoascus destructans 20631-21] EMC95659.1 hypothetical protein BAUCODRAFT_34428 [Baudoinia panamericana UAMH 10762] EME42110.1 hypothetical protein DOTSEDRAFT_89592 [Dothistroma septosporum NZE10] EME81004.1 hypothetical protein MYCFIDRAFT_76942 [Pseudocercospora fijiensis CIRAD86] EON65578.1 histone H3 [Coniosporium apollinis CBS 100218] EPE25791.1 Histone-fold containing protein [Glarea lozoyensis ATCC 20868] EPQ65912.1 histone H3 protein [Blumeria graminis f. sp. tritici 96224] EPQ66293.1 hypothetical protein BGT96224_1778 [Blumeria graminis f. sp. tritici 96224] CCU82995.1 histone H3 [Blumeria graminis f. sp. hordei DH14] CCU82905.1 Histone H3 [Blumeria graminis f. sp. hordei DH14] ERF75305.1 Histone H3 [Endocarpon pusillum Z07020] ETI25694.1 histone H3 [Cladophialophora carrionii CBS 160.54] EXJ57268.1 histone H3 [Cladophialophora yegresii CBS 114405] EXJ75491.1 histone H3 [Cladophialophora psammophila CBS 110553] EXJ86681.1 histone H3 [Capronia epimyces CBS 606.96] EXJ87992.1 histone H3 [Capronia coronata CBS 617.96] KEQ61096.1 histone cluster 1, H3g protein [Aureobasidium melanogenum CBS 110374] KEQ74764.1 histone cluster 1, H3g protein [Aureobasidium namibiae CBS 147.97] KEQ79930.1 histone cluster 1, H3g protein [Aureobasidium pullulans EXF-150] KEQ94913.1 hypothetical protein AUEXF2481DRAFT_47053 [Aureobasidium subglaciale EXF-2481] KFX90910.1 hypothetical protein V490_06204 [Pseudogymnoascus sp. VKM F-3557] KFY11630.1 hypothetical protein V491_07122 [Pseudogymnoascus sp. VKM F-3775] KFY18979.1 hypothetical protein V493_08218 [Pseudogymnoascus sp. VKM F-4281 (FW-2241)] KFY32699.1 hypothetical protein V495_08820 [Pseudogymnoascus sp. VKM F-4514 (FW-929)] KFY43528.1 hypothetical protein V494_01929 [Pseudogymnoascus sp. VKM F-4513 (FW-928)] KFY51481.1 hypothetical protein V497_09097 [Pseudogymnoascus sp. VKM F-4516 (FW-969)] KFY64841.1 hypothetical protein V496_02986 [Pseudogymnoascus sp. VKM F-4515 (FW-2607)] KFY71342.1 hypothetical protein V499_08457 [Pseudogymnoascus sp. VKM F-103] KFY96041.1 hypothetical protein V498_02955 [Pseudogymnoascus sp. VKM F-4517 (FW-2822)] KFY98548.1 hypothetical protein V500_01622 [Pseudogymnoascus sp. VKM F-4518 (FW-2643)] KFZ16392.1 hypothetical protein V502_05116 [Pseudogymnoascus sp. VKM F-4520 (FW-2644)] KFZ16836.1 hypothetical protein V501_02045 [Pseudogymnoascus sp. VKM F-4519 (FW-2642)] KHJ30903.1 putative histone H3 [Erysiphe necator] KHJ32105.1 putative histone H3 [Erysiphe necator] KIN01453.1 hypothetical protein OIDMADRAFT_19281 [Oidiodendron maius Zn] GAM82027.1 hypothetical protein ANO11243_000060 [fungal sp. No.11243] KIV79754.1 histone H3 [Exophiala sideris] KIV94907.1 histone H3 [Exophiala mesophila] KIW05440.1 histone H3 [Verruconis gallopava] KIW10573.1 histone H3 [Exophiala spinifera] KIW23618.1 histone H3 [Cladophialophora immunda] KIW46569.1 histone H3 [Exophiala oligosperma] KIW53464.1 histone H3 [Exophiala xenobiotica] KIW65871.1 histone H3 [Capronia semi-immersa] KIW83967.1 histone H3 [Fonsecaea pedrosoi CBS 271.37] KIW97707.1 histone H3 [Cladophialophora bantiana CBS 173.52] KIX03364.1 histone H3 [Rhinocladiella mackenziei CBS 650.93] KIY03681.1 histone H3 [Fonsecaea multimorphosa CBS 102226] KJX95006.1 histone H3.3 like protein [Zymoseptoria brevis] KKY17757.1 putative histone H3 [Phaeomoniella chlamydospora] ALQ33223.1 histone H3 [Golovinomyces orontii] ALQ33224.1 histone H3 [Golovinomyces orontii] ALQ33225.1 histone H3 [Golovinomyces orontii] ALQ33226.1 histone H3 [Golovinomyces orontii] ALQ33227.1 histone H3 [Golovinomyces orontii] ALQ33228.1 histone H3 [Golovinomyces orontii] ALQ33229.1 histone H3 [Golovinomyces orontii] ALQ33230.1 histone H3 [Golovinomyces orontii] ALQ33231.1 histone H3 [Golovinomyces orontii] ALQ33232.1 histone H3 [Golovinomyces orontii] ALQ33233.1 histone H3 [Golovinomyces orontii] ALQ33234.1 histone H3 [Golovinomyces orontii] ALQ33235.1 histone H3 [Golovinomyces orontii] ALQ33236.1 histone H3 [Golovinomyces orontii] ALQ33237.1 histone H3 [Golovinomyces orontii] ALQ33238.1 histone H3 [Golovinomyces orontii] ALQ33239.1 histone H3 [Golovinomyces orontii] ALQ33240.1 histone H3 [Golovinomyces orontii] ALQ33241.1 histone H3 [Golovinomyces orontii] ALQ33242.1 histone H3 [Golovinomyces orontii] ALQ33243.1 histone H3 [Golovinomyces orontii] ALQ33244.1 histone H3 [Golovinomyces orontii] ALQ33245.1 histone H3 [Golovinomyces orontii] ALQ33246.1 histone H3 [Golovinomyces orontii] ALQ33247.1 histone H3 [Golovinomyces orontii] ALQ33248.1 histone H3 [Golovinomyces orontii] ALQ33249.1 histone H3 [Golovinomyces orontii] ALQ33250.1 histone H3 [Golovinomyces orontii] ALQ33251.1 histone H3 [Golovinomyces orontii] ALQ33252.1 histone H3 [Golovinomyces orontii] ALQ33253.1 histone H3 [Golovinomyces orontii] ALQ33254.1 histone H3 [Golovinomyces orontii] ALQ33255.1 histone H3 [Golovinomyces orontii] ALQ33256.1 histone H3 [Golovinomyces orontii] ALQ33257.1 histone H3 [Golovinomyces orontii] ALQ33258.1 histone H3 [Golovinomyces orontii] ALQ33259.1 histone H3 [Golovinomyces orontii] ALQ33260.1 histone H3 [Golovinomyces orontii] ALQ33261.1 histone H3 [Golovinomyces orontii] KUJ22929.1 histone cluster 1, H3g protein [Phialocephala scopiformis] KXL44182.1 hypothetical protein FE78DRAFT_170024 [Acidomyces richmondensis] KXT04101.1 hypothetical protein AC578_4899 [Mycosphaerella eumusae] KXT17838.1 hypothetical protein AC579_5357 [Pseudocercospora musae] KYG44830.1 hypothetical protein M433DRAFT_5122 [Acidomyces richmondensis BFW] KZF25209.1 histone cluster 1, H3g protein [Xylona heveae TC161] OAF59307.1 histone H3 [Pseudogymnoascus destructans] OAL32380.1 histone H3 [Fonsecaea multimorphosa] OAP63151.1 histone H3 [Fonsecaea erecta] OBT38839.1 histone H3 [Pseudogymnoascus sp. WSF 3629] OBT65632.1 histone H3 [Pseudogymnoascus sp. 23342-1-I1] OBT78982.1 histone H3 [Pseudogymnoascus sp. 05NY08] OBT82446.1 histone H3 [Pseudogymnoascus sp. 03VT05] OBT94272.1 histone H3 [Pseudogymnoascus verrucosus] OCT46950.1 histone H3 [Cladophialophora carrionii] CZT52688.1 Histone H3 [Rhynchosporium secalis] CZT13461.1 Histone H3 [Rhynchosporium agropyri] CZT04290.1 Histone H3 [Rhynchosporium commune] CZR52145.1 Histone H3 [Phialocephala subalpina] Length = 136 Score = 156 bits (394), Expect = 3e-47 Identities = 79/79 (100%), Positives = 79/79 (100%) Frame = -3 Query: 238 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 59 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 60 Query: 58 LLIRKLPFQRLVREIAQDF 2 LLIRKLPFQRLVREIAQDF Sbjct: 61 LLIRKLPFQRLVREIAQDF 79 >XP_001548662.1 histone H3 [Botrytis cinerea B05.10] XP_001589886.1 histone H3 [Sclerotinia sclerotiorum 1980] XP_001941889.1 histone H3 [Pyrenophora tritici-repentis Pt-1C-BFP] XP_003302878.1 hypothetical protein PTT_14862 [Pyrenophora teres f. teres 0-1] XP_003845436.1 similar to histone H3.3 [Leptosphaeria maculans JN3] XP_007682285.1 hypothetical protein COCMIDRAFT_79619 [Bipolaris oryzae ATCC 44560] XP_007697545.1 hypothetical protein COCSADRAFT_34966 [Bipolaris sorokiniana ND90Pr] XP_007716344.1 hypothetical protein COCCADRAFT_40258 [Bipolaris zeicola 26-R-13] XP_008027488.1 hypothetical protein SETTUDRAFT_163756 [Setosphaeria turcica Et28A] XP_014078422.1 hypothetical protein COCC4DRAFT_41284 [Bipolaris maydis ATCC 48331] XP_014551515.1 hypothetical protein COCVIDRAFT_20249 [Bipolaris victoriae FI3] XP_018380551.1 histone-fold-containing protein [Alternaria alternata] Q0UY45.1 RecName: Full=Histone H3 EDN93741.1 histone H3 [Sclerotinia sclerotiorum 1980 UF-70] EDU44608.1 histone H3 [Pyrenophora tritici-repentis Pt-1C-BFP] EFQ89054.1 hypothetical protein PTT_14862 [Pyrenophora teres f. teres 0-1] CBY01957.1 similar to histone H3.3 [Leptosphaeria maculans JN3] CCD46913.1 similar to histone H3.3 [Botrytis cinerea T4] EMD66446.1 hypothetical protein COCSADRAFT_34966 [Bipolaris sorokiniana ND90Pr] EMD84642.1 hypothetical protein COCHEDRAFT_1122518 [Bipolaris maydis C5] EMD97023.1 hypothetical protein COCHEDRAFT_10216 [Bipolaris maydis C5] EMR82379.1 putative histone h3 protein [Botrytis cinerea BcDW1] ENI04513.1 hypothetical protein COCC4DRAFT_41284 [Bipolaris maydis ATCC 48331] EOA84992.1 hypothetical protein SETTUDRAFT_163756 [Setosphaeria turcica Et28A] ESZ94719.1 histone 3 [Sclerotinia borealis F-4128] EUC29360.1 hypothetical protein COCCADRAFT_40258 [Bipolaris zeicola 26-R-13] EUC51434.1 hypothetical protein COCMIDRAFT_79619 [Bipolaris oryzae ATCC 44560] EUN21968.1 hypothetical protein COCVIDRAFT_20249 [Bipolaris victoriae FI3] KNG50511.1 histone H3 [Stemphylium lycopersici] KZM26197.1 hypothetical protein ST47_g2701 [Ascochyta rabiei] OAG15130.1 histone-fold-containing protein [Alternaria alternata] OAL01475.1 histone-fold-containing protein [Stagonospora sp. SRC1lsM3a] OAL45106.1 histone-fold-containing protein [Pyrenochaeta sp. DS3sAY3a] OCK79208.1 histone-fold-containing protein [Lepidopterella palustris CBS 459.81] OCK94332.1 histone-fold-containing protein [Cenococcum geophilum 1.58] OCL04791.1 histone-fold-containing protein [Glonium stellatum] APA15589.1 hypothetical protein sscle_15g103590 [Sclerotinia sclerotiorum 1980 UF-70] Length = 136 Score = 156 bits (394), Expect = 3e-47 Identities = 79/79 (100%), Positives = 79/79 (100%) Frame = -3 Query: 238 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 59 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 60 Query: 58 LLIRKLPFQRLVREIAQDF 2 LLIRKLPFQRLVREIAQDF Sbjct: 61 LLIRKLPFQRLVREIAQDF 79 >BAD90774.1 histone 3 [Conocephalum supradecompositum] Length = 136 Score = 156 bits (394), Expect = 3e-47 Identities = 79/79 (100%), Positives = 79/79 (100%) Frame = -3 Query: 238 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 59 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 60 Query: 58 LLIRKLPFQRLVREIAQDF 2 LLIRKLPFQRLVREIAQDF Sbjct: 61 LLIRKLPFQRLVREIAQDF 79 >BAD90802.1 histone 3 [Conocephalum conicum] Length = 136 Score = 156 bits (394), Expect = 3e-47 Identities = 79/79 (100%), Positives = 79/79 (100%) Frame = -3 Query: 238 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 59 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 60 Query: 58 LLIRKLPFQRLVREIAQDF 2 LLIRKLPFQRLVREIAQDF Sbjct: 61 LLIRKLPFQRLVREIAQDF 79 >BAD90790.1 histone 3 [Marchantia polymorpha] Length = 136 Score = 156 bits (394), Expect = 3e-47 Identities = 79/79 (100%), Positives = 79/79 (100%) Frame = -3 Query: 238 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 59 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 60 Query: 58 LLIRKLPFQRLVREIAQDF 2 LLIRKLPFQRLVREIAQDF Sbjct: 61 LLIRKLPFQRLVREIAQDF 79 >BAD90769.1 histone 3 [Conocephalum supradecompositum] Length = 136 Score = 156 bits (394), Expect = 3e-47 Identities = 79/79 (100%), Positives = 79/79 (100%) Frame = -3 Query: 238 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 59 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 60 Query: 58 LLIRKLPFQRLVREIAQDF 2 LLIRKLPFQRLVREIAQDF Sbjct: 61 LLIRKLPFQRLVREIAQDF 79 >BAD90759.1 histone 3 [Conocephalum conicum] Length = 136 Score = 156 bits (394), Expect = 3e-47 Identities = 79/79 (100%), Positives = 79/79 (100%) Frame = -3 Query: 238 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 59 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTE 60 Query: 58 LLIRKLPFQRLVREIAQDF 2 LLIRKLPFQRLVREIAQDF Sbjct: 61 LLIRKLPFQRLVREIAQDF 79