BLASTX nr result
ID: Phellodendron21_contig00033750
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00033750 (262 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006480978.1 PREDICTED: BTB/POZ domain-containing protein At3g... 70 5e-12 XP_006429321.1 hypothetical protein CICLE_v10011651mg [Citrus cl... 70 5e-12 OAY41458.1 hypothetical protein MANES_09G103400 [Manihot esculenta] 63 1e-09 XP_004305142.1 PREDICTED: BTB/POZ domain-containing protein At3g... 62 2e-09 XP_015582195.1 PREDICTED: BTB/POZ domain-containing protein At3g... 61 5e-09 EEF31035.1 protein binding protein, putative [Ricinus communis] 61 5e-09 XP_012087893.1 PREDICTED: BTB/POZ domain-containing protein At3g... 61 6e-09 XP_008239503.1 PREDICTED: BTB/POZ domain-containing protein At3g... 61 6e-09 XP_002279057.1 PREDICTED: BTB/POZ domain-containing protein At3g... 60 9e-09 CBI30416.3 unnamed protein product, partial [Vitis vinifera] 60 9e-09 XP_007207436.1 hypothetical protein PRUPE_ppa005085mg [Prunus pe... 60 1e-08 CDP20414.1 unnamed protein product [Coffea canephora] 59 2e-08 XP_008363906.1 PREDICTED: BTB/POZ domain-containing protein At3g... 59 3e-08 XP_009338875.1 PREDICTED: BTB/POZ domain-containing protein At3g... 59 4e-08 XP_009358859.1 PREDICTED: BTB/POZ domain-containing protein At3g... 59 4e-08 XP_008388193.1 PREDICTED: BTB/POZ domain-containing protein At3g... 59 4e-08 CDP20415.1 unnamed protein product [Coffea canephora] 59 4e-08 XP_009409489.1 PREDICTED: BTB/POZ domain-containing protein At3g... 59 4e-08 KZV37399.1 BTB/POZ domain-containing protein-like [Dorcoceras hy... 58 6e-08 OAY73183.1 BTB/POZ domain-containing protein [Ananas comosus] 58 8e-08 >XP_006480978.1 PREDICTED: BTB/POZ domain-containing protein At3g09030 [Citrus sinensis] KDO53252.1 hypothetical protein CISIN_1g012060mg [Citrus sinensis] Length = 472 Score = 69.7 bits (169), Expect = 5e-12 Identities = 38/51 (74%), Positives = 40/51 (78%), Gaps = 5/51 (9%) Frame = +3 Query: 123 ASRFSNQELVDEALYYDIKSQLKSALSPPPLQGIDA-----IYLAADALPS 260 ASRFS QEL DEALYY I SQLKSA+SPPPLQGIDA + AADALPS Sbjct: 82 ASRFSKQELADEALYYGIDSQLKSAMSPPPLQGIDASIVSTVRPAADALPS 132 >XP_006429321.1 hypothetical protein CICLE_v10011651mg [Citrus clementina] ESR42561.1 hypothetical protein CICLE_v10011651mg [Citrus clementina] Length = 472 Score = 69.7 bits (169), Expect = 5e-12 Identities = 38/51 (74%), Positives = 40/51 (78%), Gaps = 5/51 (9%) Frame = +3 Query: 123 ASRFSNQELVDEALYYDIKSQLKSALSPPPLQGIDA-----IYLAADALPS 260 ASRFS QEL DEALYY I SQLKSA+SPPPLQGIDA + AADALPS Sbjct: 82 ASRFSKQELADEALYYGIDSQLKSAMSPPPLQGIDASIVSTVRPAADALPS 132 >OAY41458.1 hypothetical protein MANES_09G103400 [Manihot esculenta] Length = 473 Score = 62.8 bits (151), Expect = 1e-09 Identities = 33/51 (64%), Positives = 38/51 (74%), Gaps = 5/51 (9%) Frame = +3 Query: 123 ASRFSNQELVDEALYYDIKSQLKSALSPPPLQGIDA-----IYLAADALPS 260 A RFS QEL DEALYY I+SQL+ A+SPPPL GIDA I+ A+D LPS Sbjct: 80 AQRFSKQELADEALYYGIESQLRFAMSPPPLSGIDASLVTTIHPASDGLPS 130 >XP_004305142.1 PREDICTED: BTB/POZ domain-containing protein At3g09030 [Fragaria vesca subsp. vesca] Length = 474 Score = 62.0 bits (149), Expect = 2e-09 Identities = 33/51 (64%), Positives = 37/51 (72%), Gaps = 5/51 (9%) Frame = +3 Query: 123 ASRFSNQELVDEALYYDIKSQLKSALSPPPLQGIDA-----IYLAADALPS 260 A RFS QEL DEALYY I+SQLKSA+ PPPL GIDA + A+D LPS Sbjct: 82 ARRFSKQELTDEALYYGIESQLKSAMLPPPLSGIDASIVTTVQPASDGLPS 132 >XP_015582195.1 PREDICTED: BTB/POZ domain-containing protein At3g09030 [Ricinus communis] Length = 467 Score = 61.2 bits (147), Expect = 5e-09 Identities = 32/51 (62%), Positives = 37/51 (72%), Gaps = 5/51 (9%) Frame = +3 Query: 123 ASRFSNQELVDEALYYDIKSQLKSALSPPPLQGIDAIYL-----AADALPS 260 A+RFS QEL DEALYY I+S LKSA+SPPPL GIDA + A+D PS Sbjct: 80 ATRFSKQELADEALYYGIESHLKSAMSPPPLSGIDASLVTTLRPASDGFPS 130 >EEF31035.1 protein binding protein, putative [Ricinus communis] Length = 499 Score = 61.2 bits (147), Expect = 5e-09 Identities = 32/51 (62%), Positives = 37/51 (72%), Gaps = 5/51 (9%) Frame = +3 Query: 123 ASRFSNQELVDEALYYDIKSQLKSALSPPPLQGIDAIYL-----AADALPS 260 A+RFS QEL DEALYY I+S LKSA+SPPPL GIDA + A+D PS Sbjct: 80 ATRFSKQELADEALYYGIESHLKSAMSPPPLSGIDASLVTTLRPASDGFPS 130 >XP_012087893.1 PREDICTED: BTB/POZ domain-containing protein At3g09030 [Jatropha curcas] XP_012087894.1 PREDICTED: BTB/POZ domain-containing protein At3g09030 [Jatropha curcas] KDP24478.1 hypothetical protein JCGZ_25042 [Jatropha curcas] Length = 466 Score = 60.8 bits (146), Expect = 6e-09 Identities = 32/51 (62%), Positives = 37/51 (72%), Gaps = 5/51 (9%) Frame = +3 Query: 123 ASRFSNQELVDEALYYDIKSQLKSALSPPPLQGIDA-----IYLAADALPS 260 A RFS QEL DEA YY I+SQL+ A+SPPPL GIDA I+ A+D LPS Sbjct: 74 AQRFSKQELADEATYYGIESQLRLAMSPPPLSGIDASQVATIHPASDGLPS 124 >XP_008239503.1 PREDICTED: BTB/POZ domain-containing protein At3g09030 isoform X3 [Prunus mume] XP_016651802.1 PREDICTED: BTB/POZ domain-containing protein At3g09030 isoform X3 [Prunus mume] XP_016651803.1 PREDICTED: BTB/POZ domain-containing protein At3g09030 isoform X3 [Prunus mume] Length = 478 Score = 60.8 bits (146), Expect = 6e-09 Identities = 32/51 (62%), Positives = 36/51 (70%), Gaps = 5/51 (9%) Frame = +3 Query: 123 ASRFSNQELVDEALYYDIKSQLKSALSPPPLQGIDA-----IYLAADALPS 260 A RFS QEL DEALYY I+SQLKSA+SPPP GIDA + A+D PS Sbjct: 82 ARRFSKQELADEALYYGIESQLKSAMSPPPFSGIDASIVTTVQPASDGCPS 132 >XP_002279057.1 PREDICTED: BTB/POZ domain-containing protein At3g09030 [Vitis vinifera] Length = 475 Score = 60.5 bits (145), Expect = 9e-09 Identities = 33/51 (64%), Positives = 37/51 (72%), Gaps = 5/51 (9%) Frame = +3 Query: 123 ASRFSNQELVDEALYYDIKSQLKSALSPPPLQGIDA-----IYLAADALPS 260 A RFS QEL DEALYY I+S+LKSA+ PPPL GIDA I A+D LPS Sbjct: 82 ARRFSKQELTDEALYYGIESRLKSAMLPPPLSGIDASVVATIRPASDGLPS 132 >CBI30416.3 unnamed protein product, partial [Vitis vinifera] Length = 483 Score = 60.5 bits (145), Expect = 9e-09 Identities = 33/51 (64%), Positives = 37/51 (72%), Gaps = 5/51 (9%) Frame = +3 Query: 123 ASRFSNQELVDEALYYDIKSQLKSALSPPPLQGIDA-----IYLAADALPS 260 A RFS QEL DEALYY I+S+LKSA+ PPPL GIDA I A+D LPS Sbjct: 113 ARRFSKQELTDEALYYGIESRLKSAMLPPPLSGIDASVVATIRPASDGLPS 163 >XP_007207436.1 hypothetical protein PRUPE_ppa005085mg [Prunus persica] ONI03657.1 hypothetical protein PRUPE_6G272700 [Prunus persica] Length = 478 Score = 60.1 bits (144), Expect = 1e-08 Identities = 32/51 (62%), Positives = 35/51 (68%), Gaps = 5/51 (9%) Frame = +3 Query: 123 ASRFSNQELVDEALYYDIKSQLKSALSPPPLQGIDA-----IYLAADALPS 260 A RFS QEL DEALYY I SQLKSA+SPPP GIDA + A+D PS Sbjct: 82 ARRFSKQELADEALYYGIDSQLKSAMSPPPFSGIDASIVTTVQPASDGCPS 132 >CDP20414.1 unnamed protein product [Coffea canephora] Length = 214 Score = 58.5 bits (140), Expect = 2e-08 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +3 Query: 123 ASRFSNQELVDEALYYDIKSQLKSALSPPPLQGIDA 230 A RFSNQEL+DEA YY I+SQLKSAL+P PL GIDA Sbjct: 86 AKRFSNQELIDEASYYGIESQLKSALAPSPLTGIDA 121 >XP_008363906.1 PREDICTED: BTB/POZ domain-containing protein At3g09030-like [Malus domestica] XP_008363907.1 PREDICTED: BTB/POZ domain-containing protein At3g09030-like [Malus domestica] Length = 478 Score = 58.9 bits (141), Expect = 3e-08 Identities = 31/51 (60%), Positives = 35/51 (68%), Gaps = 5/51 (9%) Frame = +3 Query: 123 ASRFSNQELVDEALYYDIKSQLKSALSPPPLQGIDA-----IYLAADALPS 260 A RFS QEL DEALYY I+SQLKS +SPPP GIDA + A+D PS Sbjct: 82 ARRFSKQELADEALYYGIESQLKSVMSPPPFSGIDASIVTTVQPASDGRPS 132 >XP_009338875.1 PREDICTED: BTB/POZ domain-containing protein At3g09030-like [Pyrus x bretschneideri] XP_009338876.1 PREDICTED: BTB/POZ domain-containing protein At3g09030-like [Pyrus x bretschneideri] Length = 478 Score = 58.5 bits (140), Expect = 4e-08 Identities = 32/51 (62%), Positives = 35/51 (68%), Gaps = 5/51 (9%) Frame = +3 Query: 123 ASRFSNQELVDEALYYDIKSQLKSALSPPPLQGIDA-----IYLAADALPS 260 A FS QEL DEALYY I+SQLKSA+SPPPL GIDA + A D PS Sbjct: 82 ARLFSKQELADEALYYGIESQLKSAMSPPPLSGIDASIVTTVQPAYDGCPS 132 >XP_009358859.1 PREDICTED: BTB/POZ domain-containing protein At3g09030-like [Pyrus x bretschneideri] XP_009358860.1 PREDICTED: BTB/POZ domain-containing protein At3g09030-like [Pyrus x bretschneideri] XP_009358861.1 PREDICTED: BTB/POZ domain-containing protein At3g09030-like [Pyrus x bretschneideri] Length = 478 Score = 58.5 bits (140), Expect = 4e-08 Identities = 32/51 (62%), Positives = 35/51 (68%), Gaps = 5/51 (9%) Frame = +3 Query: 123 ASRFSNQELVDEALYYDIKSQLKSALSPPPLQGIDA-----IYLAADALPS 260 A FS QEL DEALYY I+SQLKSA+SPPPL GIDA + A D PS Sbjct: 82 ARLFSKQELADEALYYGIESQLKSAMSPPPLSGIDASIVTTVQPAYDGCPS 132 >XP_008388193.1 PREDICTED: BTB/POZ domain-containing protein At3g09030 [Malus domestica] XP_008388194.1 PREDICTED: BTB/POZ domain-containing protein At3g09030 [Malus domestica] XP_008388195.1 PREDICTED: BTB/POZ domain-containing protein At3g09030 [Malus domestica] XP_008388196.1 PREDICTED: BTB/POZ domain-containing protein At3g09030 [Malus domestica] Length = 478 Score = 58.5 bits (140), Expect = 4e-08 Identities = 32/51 (62%), Positives = 35/51 (68%), Gaps = 5/51 (9%) Frame = +3 Query: 123 ASRFSNQELVDEALYYDIKSQLKSALSPPPLQGIDA-----IYLAADALPS 260 A FS QEL DEALYY I+SQLKSA+SPPPL GIDA + A D PS Sbjct: 82 ARLFSKQELADEALYYGIESQLKSAMSPPPLSGIDASIVTTVQPAYDGCPS 132 >CDP20415.1 unnamed protein product [Coffea canephora] Length = 482 Score = 58.5 bits (140), Expect = 4e-08 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +3 Query: 123 ASRFSNQELVDEALYYDIKSQLKSALSPPPLQGIDA 230 A RFSNQEL+DEA YY I+SQLKSAL+P PL GIDA Sbjct: 86 AKRFSNQELIDEASYYGIESQLKSALAPSPLTGIDA 121 >XP_009409489.1 PREDICTED: BTB/POZ domain-containing protein At3g09030 [Musa acuminata subsp. malaccensis] Length = 492 Score = 58.5 bits (140), Expect = 4e-08 Identities = 28/52 (53%), Positives = 40/52 (76%), Gaps = 5/52 (9%) Frame = +3 Query: 120 IASRFSNQELVDEALYYDIKSQLKSALSPPPLQGIDAIYL-----AADALPS 260 + SRFSNQ+L++EALYY ++++L+SALSPPPL G DA + A+DA P+ Sbjct: 87 VLSRFSNQDLLEEALYYGVEARLRSALSPPPLVGFDATLVATLRPASDAFPT 138 >KZV37399.1 BTB/POZ domain-containing protein-like [Dorcoceras hygrometricum] Length = 599 Score = 58.2 bits (139), Expect = 6e-08 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +3 Query: 123 ASRFSNQELVDEALYYDIKSQLKSALSPPPLQGIDA 230 A RFSNQEL+DEALYY I+SQLKSAL+P L GIDA Sbjct: 208 AKRFSNQELIDEALYYGIESQLKSALAPSQLNGIDA 243 >OAY73183.1 BTB/POZ domain-containing protein [Ananas comosus] Length = 472 Score = 57.8 bits (138), Expect = 8e-08 Identities = 30/56 (53%), Positives = 39/56 (69%), Gaps = 5/56 (8%) Frame = +3 Query: 108 PSIGIASRFSNQELVDEALYYDIKSQLKSALSPPPLQGIDA-----IYLAADALPS 260 PS A RFS Q+L+DEALYY + S+L++A +PPPL G DA + AADALP+ Sbjct: 83 PSSAAARRFSEQDLLDEALYYGLDSRLRAATAPPPLLGFDAFLSATLVPAADALPT 138