BLASTX nr result
ID: Phellodendron21_contig00033720
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00033720 (481 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007408988.1 hypothetical protein MELLADRAFT_85525 [Melampsora... 86 7e-18 >XP_007408988.1 hypothetical protein MELLADRAFT_85525 [Melampsora larici-populina 98AG31] EGG07656.1 hypothetical protein MELLADRAFT_85525 [Melampsora larici-populina 98AG31] Length = 220 Score = 86.3 bits (212), Expect = 7e-18 Identities = 40/78 (51%), Positives = 55/78 (70%) Frame = -1 Query: 481 GSKFVFNREYLGKGGQIKNEKSGKIIATLSVEERKEPWLLSLFHSKTAFVLRTDGAVPAY 302 G K+ F+R + G+I + K++ATL E+R EPWLLS FH+ A+VLR+DG VP Y Sbjct: 143 GFKYEFDRNAMSADGKIFEADNKKLVATLHTEKRHEPWLLSRFHADDAYVLRSDGTVPDY 202 Query: 301 QLAALLALVEMRVDTCGL 248 L L+ALV+MRV+TCG+ Sbjct: 203 YLVTLMALVQMRVNTCGI 220