BLASTX nr result
ID: Phellodendron21_contig00033710
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00033710 (417 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007406176.1 hypothetical protein MELLADRAFT_115470 [Melampsor... 74 8e-13 >XP_007406176.1 hypothetical protein MELLADRAFT_115470 [Melampsora larici-populina 98AG31] EGG10707.1 hypothetical protein MELLADRAFT_115470 [Melampsora larici-populina 98AG31] Length = 1615 Score = 74.3 bits (181), Expect = 8e-13 Identities = 38/64 (59%), Positives = 46/64 (71%), Gaps = 1/64 (1%) Frame = +3 Query: 3 KNPSKPLNENQQKWFDLIVAALKDDRDPSGDMLS-VKNEPGRLRNAEAPKKKTMTVVLAR 179 KNPSKP +E QQ+WF+LIVAALKD++D M S N+ GR EA KKKTMTVV+AR Sbjct: 1547 KNPSKPFSEKQQRWFNLIVAALKDEKDNIPGMFSDTNNDMGRSLKGEASKKKTMTVVIAR 1606 Query: 180 AGTE 191 G + Sbjct: 1607 PGRD 1610