BLASTX nr result
ID: Phellodendron21_contig00033615
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00033615 (627 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006487352.1 PREDICTED: putative pentatricopeptide repeat-cont... 58 2e-06 >XP_006487352.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Citrus sinensis] Length = 649 Score = 58.2 bits (139), Expect = 2e-06 Identities = 38/86 (44%), Positives = 50/86 (58%), Gaps = 9/86 (10%) Frame = +1 Query: 385 YLTFKSFITTSI-LTVKGRISPDKFLKGNCR-------RLHTLNEQLCLFDYNVHIQPI- 537 YLT + + S+ LTVK R S +KFL+ C+ L T NE LC+FDY +H+ P Sbjct: 45 YLTTTAKLKESLRLTVKDRASLEKFLRKRCKPSGQGDINLITPNEALCIFDYMLHMHPSP 104 Query: 538 PYMLLFNRLFGVLAKDKLTSILILLF 615 P + FN LFG LAK K ++LLF Sbjct: 105 PPVTSFNILFGCLAKTKHYDTVLLLF 130