BLASTX nr result
ID: Phellodendron21_contig00033564
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00033564 (340 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007413003.1 hypothetical protein MELLADRAFT_89799 [Melampsora... 76 5e-14 >XP_007413003.1 hypothetical protein MELLADRAFT_89799 [Melampsora larici-populina 98AG31] EGG03889.1 hypothetical protein MELLADRAFT_89799 [Melampsora larici-populina 98AG31] Length = 319 Score = 75.9 bits (185), Expect = 5e-14 Identities = 45/100 (45%), Positives = 59/100 (59%) Frame = -1 Query: 322 SRHAEWCEEDESVQLKPRSKGSPIKMTRRFRPSLPTDAHPMTSGLLQAGKREEGKAAEPN 143 S ++EW E+D+ Q K R K SP+K T R+RP L S Q G P Sbjct: 192 SPYSEWYEDDDDSQSK-RRKNSPVKSTSRYRPQLQILTTSTNSHRFQPA----GPEKPPA 246 Query: 142 RSNRFPQIRIELPPIALLAEDLSDDEKIST*SEFFKSPVI 23 R ++ I IELPP+ALLAED+SD+EK ST S+F KSP++ Sbjct: 247 RRSQSGHIPIELPPMALLAEDVSDEEKPSTWSDFLKSPIM 286