BLASTX nr result
ID: Phellodendron21_contig00033488
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00033488 (544 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007415827.1 hypothetical protein MELLADRAFT_73100 [Melampsora... 67 7e-10 >XP_007415827.1 hypothetical protein MELLADRAFT_73100 [Melampsora larici-populina 98AG31] EGG00979.1 hypothetical protein MELLADRAFT_73100 [Melampsora larici-populina 98AG31] Length = 825 Score = 67.4 bits (163), Expect = 7e-10 Identities = 31/55 (56%), Positives = 42/55 (76%) Frame = +3 Query: 3 LPRDELKLSSEAVKLLAEDQIVATDEGSEMDSKGQVTVTRNPPGETESIEIPSKD 167 LP+D L LS EA+KLL E +I A+DEG++M + G+V VT+NPPGE + I+IP D Sbjct: 770 LPKDPLGLSIEAIKLLGESKIDASDEGAKMGTDGKVVVTKNPPGEIDDIDIPEND 824