BLASTX nr result
ID: Phellodendron21_contig00033461
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00033461 (369 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO42067.1 hypothetical protein CISIN_1g000934mg [Citrus sinensis] 72 4e-12 XP_006431436.1 hypothetical protein CICLE_v10000063mg [Citrus cl... 72 4e-12 KDO42065.1 hypothetical protein CISIN_1g000934mg [Citrus sinensis] 72 4e-12 XP_011028411.1 PREDICTED: cullin-associated NEDD8-dissociated pr... 63 4e-09 OMO65586.1 Armadillo-like helical [Corchorus olitorius] 63 4e-09 XP_011028409.1 PREDICTED: cullin-associated NEDD8-dissociated pr... 63 4e-09 XP_007023141.1 PREDICTED: cullin-associated NEDD8-dissociated pr... 63 4e-09 XP_006385092.1 TIP120 family protein [Populus trichocarpa] ERP62... 63 4e-09 XP_011003703.1 PREDICTED: cullin-associated NEDD8-dissociated pr... 62 1e-08 XP_015878699.1 PREDICTED: cullin-associated NEDD8-dissociated pr... 62 1e-08 XP_002527826.1 PREDICTED: cullin-associated NEDD8-dissociated pr... 62 1e-08 XP_018817814.1 PREDICTED: cullin-associated NEDD8-dissociated pr... 62 1e-08 XP_010110459.1 hypothetical protein L484_001858 [Morus notabilis... 61 2e-08 KZN09071.1 hypothetical protein DCAR_001727 [Daucus carota subsp... 60 3e-08 GAV63309.1 TIP120 domain-containing protein [Cephalotus follicul... 60 3e-08 XP_017228743.1 PREDICTED: cullin-associated NEDD8-dissociated pr... 60 3e-08 OMO95503.1 Armadillo-like helical [Corchorus capsularis] 60 3e-08 XP_016194927.1 PREDICTED: cullin-associated NEDD8-dissociated pr... 60 6e-08 XP_015940075.1 PREDICTED: cullin-associated NEDD8-dissociated pr... 60 6e-08 XP_012066762.1 PREDICTED: cullin-associated NEDD8-dissociated pr... 60 6e-08 >KDO42067.1 hypothetical protein CISIN_1g000934mg [Citrus sinensis] Length = 1215 Score = 71.6 bits (174), Expect = 4e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 3 ISGGDCSMKFKSLMSEISKSPMLWEKFYTIRNE 101 ISGGDCSMKFKSLMSEISKSPMLWEKFYTIRNE Sbjct: 1183 ISGGDCSMKFKSLMSEISKSPMLWEKFYTIRNE 1215 >XP_006431436.1 hypothetical protein CICLE_v10000063mg [Citrus clementina] XP_006431437.1 hypothetical protein CICLE_v10000063mg [Citrus clementina] XP_006470834.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1 [Citrus sinensis] XP_006470835.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1 [Citrus sinensis] ESR44676.1 hypothetical protein CICLE_v10000063mg [Citrus clementina] ESR44677.1 hypothetical protein CICLE_v10000063mg [Citrus clementina] KDO42066.1 hypothetical protein CISIN_1g000934mg [Citrus sinensis] Length = 1218 Score = 71.6 bits (174), Expect = 4e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 3 ISGGDCSMKFKSLMSEISKSPMLWEKFYTIRNE 101 ISGGDCSMKFKSLMSEISKSPMLWEKFYTIRNE Sbjct: 1186 ISGGDCSMKFKSLMSEISKSPMLWEKFYTIRNE 1218 >KDO42065.1 hypothetical protein CISIN_1g000934mg [Citrus sinensis] Length = 1219 Score = 71.6 bits (174), Expect = 4e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 3 ISGGDCSMKFKSLMSEISKSPMLWEKFYTIRNE 101 ISGGDCSMKFKSLMSEISKSPMLWEKFYTIRNE Sbjct: 1187 ISGGDCSMKFKSLMSEISKSPMLWEKFYTIRNE 1219 >XP_011028411.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1 isoform X2 [Populus euphratica] Length = 993 Score = 63.2 bits (152), Expect = 4e-09 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +3 Query: 3 ISGGDCSMKFKSLMSEISKSPMLWEKFYTIRNE 101 ISGGDCS+KFK+LMSEISKSP LW+K+Y+IRNE Sbjct: 961 ISGGDCSLKFKNLMSEISKSPTLWDKYYSIRNE 993 >OMO65586.1 Armadillo-like helical [Corchorus olitorius] Length = 1134 Score = 63.2 bits (152), Expect = 4e-09 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +3 Query: 3 ISGGDCSMKFKSLMSEISKSPMLWEKFYTIRNE 101 ISGGDCS+KFK+LMSEISKSP LW+K+Y+IRNE Sbjct: 1102 ISGGDCSLKFKNLMSEISKSPTLWDKYYSIRNE 1134 >XP_011028409.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1 isoform X1 [Populus euphratica] XP_011028410.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1 isoform X1 [Populus euphratica] Length = 1218 Score = 63.2 bits (152), Expect = 4e-09 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +3 Query: 3 ISGGDCSMKFKSLMSEISKSPMLWEKFYTIRNE 101 ISGGDCS+KFK+LMSEISKSP LW+K+Y+IRNE Sbjct: 1186 ISGGDCSLKFKNLMSEISKSPTLWDKYYSIRNE 1218 >XP_007023141.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1 [Theobroma cacao] EOY25763.1 Cullin-associated and neddylation dissociated [Theobroma cacao] Length = 1218 Score = 63.2 bits (152), Expect = 4e-09 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +3 Query: 3 ISGGDCSMKFKSLMSEISKSPMLWEKFYTIRNE 101 ISGGDCS+KFK+LMSEISKSP LW+K+Y+IRNE Sbjct: 1186 ISGGDCSLKFKNLMSEISKSPTLWDKYYSIRNE 1218 >XP_006385092.1 TIP120 family protein [Populus trichocarpa] ERP62889.1 TIP120 family protein [Populus trichocarpa] Length = 1223 Score = 63.2 bits (152), Expect = 4e-09 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +3 Query: 3 ISGGDCSMKFKSLMSEISKSPMLWEKFYTIRNE 101 ISGGDCS+KFK+LMSEISKSP LW+K+Y+IRNE Sbjct: 1191 ISGGDCSLKFKNLMSEISKSPTLWDKYYSIRNE 1223 >XP_011003703.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1-like [Populus euphratica] XP_011003704.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1-like [Populus euphratica] Length = 1217 Score = 61.6 bits (148), Expect = 1e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +3 Query: 6 SGGDCSMKFKSLMSEISKSPMLWEKFYTIRNE 101 SGGDCS+KFK+LMSEISKSP LW+K+Y+IRNE Sbjct: 1186 SGGDCSLKFKNLMSEISKSPTLWDKYYSIRNE 1217 >XP_015878699.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1 [Ziziphus jujuba] Length = 1218 Score = 61.6 bits (148), Expect = 1e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 3 ISGGDCSMKFKSLMSEISKSPMLWEKFYTIRNE 101 ISGGDCS KFK+LM+EISKSP LWEK+Y+IRNE Sbjct: 1186 ISGGDCSHKFKNLMNEISKSPALWEKYYSIRNE 1218 >XP_002527826.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1 [Ricinus communis] EEF34529.1 tip120, putative [Ricinus communis] Length = 1218 Score = 61.6 bits (148), Expect = 1e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 3 ISGGDCSMKFKSLMSEISKSPMLWEKFYTIRNE 101 ISGGDCS KFK+LM+EISKSP LWEK+Y+IRNE Sbjct: 1186 ISGGDCSHKFKNLMNEISKSPTLWEKYYSIRNE 1218 >XP_018817814.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1 [Juglans regia] Length = 1219 Score = 61.6 bits (148), Expect = 1e-08 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +3 Query: 3 ISGGDCSMKFKSLMSEISKSPMLWEKFYTIRNE 101 ISGGDC +KFKSLM+EIS+SP LWEK+Y+IRNE Sbjct: 1187 ISGGDCGLKFKSLMTEISRSPALWEKYYSIRNE 1219 >XP_010110459.1 hypothetical protein L484_001858 [Morus notabilis] EXC26457.1 hypothetical protein L484_001858 [Morus notabilis] Length = 1243 Score = 61.2 bits (147), Expect = 2e-08 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +3 Query: 3 ISGGDCSMKFKSLMSEISKSPMLWEKFYTIRNE 101 ISGGDCS+KFK+LM EISKSP LW+K+Y+IRNE Sbjct: 1211 ISGGDCSLKFKNLMHEISKSPALWDKYYSIRNE 1243 >KZN09071.1 hypothetical protein DCAR_001727 [Daucus carota subsp. sativus] Length = 1175 Score = 60.5 bits (145), Expect = 3e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 3 ISGGDCSMKFKSLMSEISKSPMLWEKFYTIRNE 101 ISGGDCS KFK+LMSEISKSP LWEKF +IRNE Sbjct: 1143 ISGGDCSHKFKNLMSEISKSPTLWEKFCSIRNE 1175 >GAV63309.1 TIP120 domain-containing protein [Cephalotus follicularis] Length = 1218 Score = 60.5 bits (145), Expect = 3e-08 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +3 Query: 3 ISGGDCSMKFKSLMSEISKSPMLWEKFYTIRNE 101 ISGGDCS KFK+LM+EISKSP LW+K+Y+IRNE Sbjct: 1186 ISGGDCSHKFKNLMNEISKSPTLWDKYYSIRNE 1218 >XP_017228743.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1 [Daucus carota subsp. sativus] Length = 1219 Score = 60.5 bits (145), Expect = 3e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 3 ISGGDCSMKFKSLMSEISKSPMLWEKFYTIRNE 101 ISGGDCS KFK+LMSEISKSP LWEKF +IRNE Sbjct: 1187 ISGGDCSHKFKNLMSEISKSPTLWEKFCSIRNE 1219 >OMO95503.1 Armadillo-like helical [Corchorus capsularis] Length = 1224 Score = 60.5 bits (145), Expect = 3e-08 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +3 Query: 3 ISGGDCSMKFKSLMSEISKSPMLWEKFYTIRNE 101 ISGGDCS+KFK+LM EISKSP LW+K+Y+IRN+ Sbjct: 1168 ISGGDCSLKFKNLMGEISKSPTLWDKYYSIRND 1200 >XP_016194927.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1 [Arachis ipaensis] Length = 1217 Score = 59.7 bits (143), Expect = 6e-08 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +3 Query: 3 ISGGDCSMKFKSLMSEISKSPMLWEKFYTIRNE 101 ISGGDCS+KFK+LM+EISKS LWEK+Y+IRNE Sbjct: 1185 ISGGDCSVKFKNLMNEISKSQTLWEKYYSIRNE 1217 >XP_015940075.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1 [Arachis duranensis] Length = 1217 Score = 59.7 bits (143), Expect = 6e-08 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +3 Query: 3 ISGGDCSMKFKSLMSEISKSPMLWEKFYTIRNE 101 ISGGDCS+KFK+LM+EISKS LWEK+Y+IRNE Sbjct: 1185 ISGGDCSVKFKNLMNEISKSQTLWEKYYSIRNE 1217 >XP_012066762.1 PREDICTED: cullin-associated NEDD8-dissociated protein 1 [Jatropha curcas] KDP42514.1 hypothetical protein JCGZ_00311 [Jatropha curcas] Length = 1218 Score = 59.7 bits (143), Expect = 6e-08 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +3 Query: 3 ISGGDCSMKFKSLMSEISKSPMLWEKFYTIRNE 101 ISGGDCS+KFK+L +EISKSP LW+K+Y+IRNE Sbjct: 1186 ISGGDCSLKFKNLTNEISKSPTLWDKYYSIRNE 1218