BLASTX nr result
ID: Phellodendron21_contig00033343
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00033343 (419 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006438430.1 hypothetical protein CICLE_v10032693mg [Citrus cl... 62 8e-09 >XP_006438430.1 hypothetical protein CICLE_v10032693mg [Citrus clementina] ESR51670.1 hypothetical protein CICLE_v10032693mg [Citrus clementina] KDO82501.1 hypothetical protein CISIN_1g041602mg [Citrus sinensis] Length = 223 Score = 61.6 bits (148), Expect = 8e-09 Identities = 38/83 (45%), Positives = 46/83 (55%) Frame = +3 Query: 3 YGYGRRCCSRAVCFSAIAHGSYTYESCISRNLEVAFCEVAKIWVSHLGKSYHIMSPIFCL 182 YGYGRRC SRA+ SA+A GSYTYESC S N+E + + + +MS IF Sbjct: 131 YGYGRRCGSRAMSSSAMAQGSYTYESCNSINVESVSSPLQLQRYGYQFREICVMSLIFYP 190 Query: 183 CILVFIFLVLYHSDHIYCQLLLG 251 L IFLVLY +LLG Sbjct: 191 SNLFSIFLVLYCIQLYLSSILLG 213